Protein Family IF07862
Metagenome
Isolate
138
Members
48
Samples
132
Scaffolds
171.1
Avg Length
Representative Sequence
- ID
- 3300042617|Ga0466718_004473|Ga0466718_004473_100_702
- Length
- 200 aa
- Sequence
- MFDKLVKINCFSKNRILKYFAKNLLEKLYCCEINCIEIDKSVLFAHHARGCTIIASKICENVVILQNVTIGTNMKFNRINNEWENIGNPIICKKVVIADGAKILGPIIIGENSFVAAGAIVTKDMPANSIIYGINQFKPKDINYDFVFNSNMIKFEKIIEANNKLIAKYGETVSFGMNNQETFVNNLSVDSNGNSLFTKK
Sample Types
Isolate
4.3%
Metagenome
95.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
30.4%
Termitidae
26.1%
Rhinotermitidae
8.7%
Unclassified
8.7%
Termopsidae
8.7%
Passalidae
6.5%
Tenebrionidae
6.5%
Scarabaeidae
4.3%
Taxonomy
Archaea
1
Bacteria
116
Eukaryota
0
Viruses
1
Unclassified
20
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 8114544644 | Enterococcus sp. 9E7_DIV0242 9E7_DIV0242 | Isolate | |
| 2 | 3300000036 | Passalidae beetle gut microbial communities from Costa Rica - Gallery material (4MSU+4BSU+3MSU+3BSU) | Metagenome | Passalidae |
| 3 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 6 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 11 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 12 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 13 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 14 | 646311952 | Sebaldella termitidis ATCC 33386 | Isolate | Unclassified |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 17 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 23 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 26 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 27 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 28 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 29 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 30 | 2820757377 | Unclassified Bacteroidetes Mp193P4bin6 | Isolate | Unclassified |
| 31 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 32 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 33 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 34 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 35 | 8007215774 | Enterococcus sp. BWR-S5 | Isolate | Scarabaeidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2571042003 | Stenoxybacter acetivorans DSM 19021 | Isolate | Rhinotermitidae |
| 40 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 41 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 42 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
| 43 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 44 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 45 | 8007211731 | Enterococcus larvae BWM-S5 | Isolate | Scarabaeidae |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123354_10244859 | 3300010882 | Bacteria | 1834 |
| 2 | JGI24698J34947_10043253 | 3300002449 | Unclassified | 2310 |
| 3 | Ga0068302_10327410 | 3300005071 | Bacteria | 1329 |
| 4 | Ga0466698_051060 | 3300042610 | Bacteria | 1008 |
| 5 | Ga0466698_383574 | 3300042610 | Bacteria | 1992 |
| 6 | Ga0466698_388294 | 3300042610 | Unclassified | 2291 |
| 7 | Ga0466711_080309 | 3300042615 | Bacteria | 6939 |
| 8 | Ga0466715_159884 | 3300042616 | Bacteria | 1069 |
| 9 | Ga0466723_004129 | 3300042618 | Bacteria | 5294 |
| 10 | Ga0466726_018414 | 3300042619 | Archaea | 48773 |
| 11 | Ga0466735_013676 | 3300042624 | Bacteria | 7918 |
| 12 | Ga0466704_260938 | 3300042643 | Bacteria | 2021 |
| 13 | Ga0466727_275809 | 3300042655 | Bacteria | 4694 |
| 14 | Ga0123357_10125550 | 3300009784 | Bacteria | 3216 |
| 15 | Ga0466707_336397 | 3300042601 | Bacteria | 1217 |
| 16 | Ga0466716_334639 | 3300042605 | Bacteria | 3595 |
| 17 | Ga0466718_004473 | 3300042617 | Bacteria | 1315 |
| 18 | Ga0466718_048169 | 3300042617 | Unclassified | 9748 |
| 19 | Ga0466718_131103 | 3300042617 | Unclassified | 2229 |
| 20 | Ga0562379_4078 | 3300056790 | Bacteria | 8170 |
| 21 | Ga0562375_0425 | 3300056856 | Unclassified | 92367 |
| 22 | Ga0466729_222326 | 3300042621 | Bacteria | 9193 |
| 23 | Ga0466729_267225 | 3300042621 | Bacteria | 7101 |
| 24 | Ga0466704_494562 | 3300042643 | Unclassified | 1994 |
| 25 | Ga0466704_542045 | 3300042643 | Bacteria | 3303 |
| 26 | Ga0123357_10640638 | 3300009784 | Bacteria | 792 |
| 27 | 2227321900 | 2225789004 | Bacteria | 1187 |
| 28 | 2227484096 | 2225789004 | Bacteria | 4325 |
| 29 | JGI24696J40584_12720060 | 3300002834 | Unclassified | 758 |
| 30 | Ga0466690_083635 | 3300042590 | Bacteria | 1037 |
| 31 | Ga0466693_072098 | 3300042592 | Bacteria | 2080 |
| 32 | Ga0466693_267856 | 3300042592 | Bacteria | 2160 |
| 33 | Ga0466699_132204 | 3300042597 | Bacteria | 1845 |
| 34 | Ga0466707_223290 | 3300042601 | Bacteria | 57510 |
| 35 | Ga0466719_348281 | 3300042606 | Bacteria | 1280 |
| 36 | Ga0466698_147262 | 3300042610 | Bacteria | 1461 |
| 37 | Ga0466698_331438 | 3300042610 | Bacteria | 1262 |
| 38 | Ga0466712_167618 | 3300042614 | Bacteria | 10653 |
| 39 | Ga0466712_232894 | 3300042614 | Bacteria | 12479 |
| 40 | Ga0466712_323664 | 3300042614 | Bacteria | 6737 |
| 41 | Ga0466718_082825 | 3300042617 | Bacteria | 1164 |
| 42 | Ga0466723_090890 | 3300042618 | Bacteria | 4644 |
| 43 | Ga0466729_172574 | 3300042621 | Bacteria | 3512 |
| 44 | Ga0466705_075189 | 3300042612 | Bacteria | 1783 |
| 45 | Ga0466735_169173 | 3300042624 | Bacteria | 2145 |
| 46 | Ga0466703_353382 | 3300042636 | Bacteria | 28459 |
| 47 | Ga0466704_361522 | 3300042643 | Bacteria | 8686 |
| 48 | Ga0466704_510522 | 3300042643 | Bacteria | 4313 |
| 49 | Ga0123357_10104928 | 3300009784 | Unclassified | 3627 |
| 50 | Ga0123354_10292807 | 3300010882 | Bacteria | 1556 |
| 51 | Ga0068305_10053439 | 3300005083 | Bacteria | 985 |
| 52 | Ga0466692_141664 | 3300042591 | Unclassified | 5164 |
| 53 | Ga0466707_046157 | 3300042601 | Bacteria | 13856 |
| 54 | Ga0466707_188722 | 3300042601 | Bacteria | 65668 |
| 55 | Ga0466719_195364 | 3300042606 | Bacteria | 3069 |
| 56 | Ga0466720_159857 | 3300042607 | Bacteria | 7273 |
| 57 | Ga0466698_066495 | 3300042610 | Bacteria | 1666 |
| 58 | Ga0466698_497430 | 3300042610 | Unclassified | 1031 |
| 59 | Ga0466711_271391 | 3300042615 | Bacteria | 1829 |
| 60 | Ga0466715_018639 | 3300042616 | Unclassified | 6923 |
| 61 | Ga0466735_107496 | 3300042624 | Bacteria | 8455 |
| 62 | Ga0466703_073699 | 3300042636 | Bacteria | 16554 |
| 63 | Ga0466704_509882 | 3300042643 | Unclassified | 1790 |
| 64 | Ga0466708_140126 | 3300042652 | Unclassified | 1683 |
| 65 | IMNBGM34_c001352 | 3300000036 | Bacteria | 4337 |
| 66 | IMNBL1DRAFT_c0000509 | 3300000062 | Bacteria | 31993 |
| 67 | IMNBL1DRAFT_c0087516 | 3300000062 | Bacteria | 860 |
| 68 | JGI24698J34947_10039291 | 3300002449 | Bacteria | 2450 |
| 69 | JGI24698J34947_10123079 | 3300002449 | Unclassified | 1122 |
| 70 | Ga0466691_158540 | 3300042593 | Bacteria | 5043 |
| 71 | Ga0466707_332464 | 3300042601 | Bacteria | 1242 |
| 72 | Ga0466720_191140 | 3300042607 | Bacteria | 11274 |
| 73 | Ga0466722_100813 | 3300042609 | Bacteria | 34081 |
| 74 | Ga0466698_496145 | 3300042610 | Bacteria | 1423 |
| 75 | Ga0466711_150193 | 3300042615 | Bacteria | 5387 |
| 76 | Ga0466718_010515 | 3300042617 | Bacteria | 22531 |
| 77 | Ga0466718_068923 | 3300042617 | Bacteria | 5984 |
| 78 | Ga0466718_098737 | 3300042617 | Bacteria | 7926 |
| 79 | Ga0466728_027651 | 3300042620 | Bacteria | 1644 |
| 80 | Ga0562375_0352 | 3300056856 | Bacteria | 106463 |
| 81 | Ga0466705_081179 | 3300042612 | Bacteria | 19501 |
| 82 | Ga0466729_307582 | 3300042621 | Bacteria | 11189 |
| 83 | Ga0466704_070710 | 3300042643 | Bacteria | 14004 |
| 84 | Ga0466727_011196 | 3300042655 | Bacteria | 9723 |
| 85 | Ga0466727_342344 | 3300042655 | Bacteria | 1163 |
| 86 | JGI24698J34947_10120354 | 3300002449 | Unclassified | 1140 |
| 87 | JGI24698J34947_10137400 | 3300002449 | Unclassified | 1035 |
| 88 | Ga0072940_1169564 | 3300005200 | Bacteria | 867 |
| 89 | Ga0264413_119345 | 3300024493 | Unclassified | 3874 |
| 90 | Ga0466707_317091 | 3300042601 | Bacteria | 75536 |
| 91 | Ga0466707_330926 | 3300042601 | Bacteria | 2578 |
| 92 | Ga0466719_552259 | 3300042606 | Bacteria | 2912 |
| 93 | Ga0466720_208854 | 3300042607 | Bacteria | 1521 |
| 94 | Ga0466698_468332 | 3300042610 | Bacteria | 1539 |
| 95 | Ga0466712_161949 | 3300042614 | Bacteria | 2690 |
| 96 | Ga0466718_035710 | 3300042617 | Bacteria | 2697 |
| 97 | Ga0466723_209313 | 3300042618 | Bacteria | 3992 |
| 98 | Ga0562377_0071 | 3300056842 | Bacteria | 439264 |
| 99 | Ga0562375_1921 | 3300056856 | Bacteria | 25384 |
| 100 | Ga0466735_127902 | 3300042624 | Bacteria | 4663 |
| 101 | Ga0466703_060578 | 3300042636 | Bacteria | 45367 |
| 102 | Ga0466703_375614 | 3300042636 | Bacteria | 2459 |
| 103 | Ga0466704_073656 | 3300042643 | Bacteria | 1050 |
| 104 | JGI24699J35502_11118281 | 3300002509 | Bacteria | 3085 |
| 105 | JGI24699J35502_11133614 | 3300002509 | Bacteria | 12538 |
| 106 | Ga0072940_1017641 | 3300005200 | Bacteria | 746 |
| 107 | Ga0466690_067238 | 3300042590 | Bacteria | 3359 |
| 108 | Ga0466690_297509 | 3300042590 | Bacteria | 2453 |
| 109 | Ga0466696_282823 | 3300042596 | Bacteria | 1832 |
| 110 | Ga0466707_090019 | 3300042601 | Bacteria | 6773 |
| 111 | Ga0466707_385524 | 3300042601 | Bacteria | 4384 |
| 112 | Ga0466719_488791 | 3300042606 | Bacteria | 2806 |
| 113 | Ga0466720_210696 | 3300042607 | Bacteria | 2310 |
| 114 | Ga0466698_459188 | 3300042610 | Bacteria | 1900 |
| 115 | Ga0466711_318209 | 3300042615 | Viruses | 1540 |
| 116 | Ga0466711_381740 | 3300042615 | Unclassified | 1926 |
| 117 | Ga0466718_041059 | 3300042617 | Bacteria | 14369 |
| 118 | Ga0466729_034475 | 3300042621 | Bacteria | 9914 |
| 119 | Ga0466705_087333 | 3300042612 | Unclassified | 1260 |
| 120 | Ga0466705_259764 | 3300042612 | Bacteria | 108301 |
| 121 | Ga0466735_183924 | 3300042624 | Bacteria | 2046 |
| 122 | Ga0466703_167334 | 3300042636 | Bacteria | 1549 |
| 123 | Ga0466704_494932 | 3300042643 | Bacteria | 3480 |
| 124 | Ga0466709_020318 | 3300042648 | Bacteria | 1172 |
| 125 | Ga0466720_116173 | 3300042607 | Bacteria | 6086 |
| 126 | Ga0466722_125210 | 3300042609 | Bacteria | 1989 |
| 127 | Ga0466712_077023 | 3300042614 | Bacteria | 8216 |
| 128 | Ga0466718_133863 | 3300042617 | Bacteria | 3725 |
| 129 | Ga0466729_207086 | 3300042621 | Bacteria | 1878 |
| 130 | Ga0466703_331555 | 3300042636 | Bacteria | 3071 |
| 131 | Ga0466703_365377 | 3300042636 | Unclassified | 3733 |
| 132 | Ga0466709_217249 | 3300042648 | Bacteria | 1744 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00132 | Hexapep | Bacterial transferase hexapeptide (six repeats) | 88 | 123 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.