Protein Family IF07855
Metagenome
Isolate
146
Members
52
Samples
138
Scaffolds
414.64
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_645924|Ga0466715_645924_6669_8174
- Length
- 487 aa
- Sequence
- MNDIPAHGCFYAKIPFFSSFFVLFYFAARFFADIARFFAPPHAPRFHLTKALVHDILEMHAAPMGHVHYHRDKEFIVKKTMRALGIFLLLAAVFSPLYAGGGKQAVTLVMGSWRPDDTAQMNNLLAEYKKLKPNVTIQFRPTNPPDYNATLRLQLDGGTGPDLMYARSYAPGRELYNAGYFADCSGIGGVRQNFSAANLAPWQMPDGKMFAVPFAAVSHAVYYNKSIFKKEGLAIPATYEEFLALCETLAAKGYTPLANGVADEWDILEVFYLGMLPNFIGGGIERELYESGAKKLNDANFAASFKAMADAAKYLPKGFESVTYNDSQALFNTEQAVMFMDGSWTVSVYAGAPFEWGLFAMPAPAGRKTLITFHPDMAITYNKATKYPTECQEFLAWLASPAGAAVASKALPAGFFPMINAAITLDDPHANEFLALNSGKDTDARFVWPKFLDLYAPMNQAVIKVLKGEQTPQQAAGDMEAAAAKLR
Sample Types
Isolate
5.5%
Metagenome
94.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
41.2%
Kalotermitidae
27.5%
Unclassified
17.6%
Rhinotermitidae
5.9%
Termopsidae
5.9%
Blaberidae
2.0%
Taxonomy
Archaea
0
Bacteria
139
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 7 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 8 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 17 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 18 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 22 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 28 | 2820405014 | Unclassified Firmicutes Lab288P4bin88 | Isolate | Unclassified |
| 29 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 30 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 41 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 42 | 2820464928 | Unclassified Firmicutes Lab288P3bin121 | Isolate | Unclassified |
| 43 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 44 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 45 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 46 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 47 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 48 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 49 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 50 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 51 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 52 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_032276 | 3300042659 | Bacteria | 21208 |
| 2 | Ga0466702_016929 | 3300042635 | Bacteria | 1783 |
| 3 | Ga0466703_061593 | 3300042636 | Bacteria | 16078 |
| 4 | Ga0466708_170931 | 3300042652 | Bacteria | 6957 |
| 5 | Ga0466691_083023 | 3300042593 | Bacteria | 8661 |
| 6 | Ga0466696_060405 | 3300042596 | Bacteria | 4531 |
| 7 | Ga0466712_077031 | 3300042614 | Bacteria | 5736 |
| 8 | Ga0466711_029879 | 3300042615 | Bacteria | 23647 |
| 9 | Ga0466711_146877 | 3300042615 | Bacteria | 9604 |
| 10 | Ga0466711_517498 | 3300042615 | Bacteria | 14845 |
| 11 | Ga0466718_062430 | 3300042617 | Bacteria | 1647 |
| 12 | Ga0466718_072158 | 3300042617 | Bacteria | 1925 |
| 13 | JGI24698J34947_10045207 | 3300002449 | Bacteria | 2249 |
| 14 | JGI24702J35022_10092661 | 3300002462 | Bacteria | 1646 |
| 15 | Ga0072941_1005035 | 3300005201 | Bacteria | 15346 |
| 16 | Ga0466714_102801 | 3300042603 | Bacteria | 1435 |
| 17 | Ga0466719_091900 | 3300042606 | Bacteria | 3385 |
| 18 | Ga0466722_008102 | 3300042609 | Bacteria | 6990 |
| 19 | Ga0466722_066215 | 3300042609 | Bacteria | 4685 |
| 20 | Ga0466722_183552 | 3300042609 | Bacteria | 3003 |
| 21 | Ga0466705_280272 | 3300042612 | Bacteria | 21056 |
| 22 | Ga0466703_045418 | 3300042636 | Bacteria | 2229 |
| 23 | Ga0466709_067608 | 3300042648 | Bacteria | 24200 |
| 24 | Ga0466693_152830 | 3300042592 | Bacteria | 52782 |
| 25 | Ga0466699_413294 | 3300042597 | Bacteria | 25958 |
| 26 | Ga0123356_10001575 | 3300010049 | Bacteria | 25090 |
| 27 | Ga0123356_10066084 | 3300010049 | Bacteria | 3385 |
| 28 | Ga0123356_10279299 | 3300010049 | Bacteria | 1764 |
| 29 | Ga0466715_540239 | 3300042616 | Bacteria | 1691 |
| 30 | Ga0466723_031256 | 3300042618 | Bacteria | 5370 |
| 31 | Ga0466726_002498 | 3300042619 | Bacteria | 7984 |
| 32 | Ga0466728_375903 | 3300042620 | Bacteria | 11149 |
| 33 | JGI24702J35022_10017695 | 3300002462 | Bacteria | 3891 |
| 34 | JGI24702J35022_10128948 | 3300002462 | Bacteria | 1403 |
| 35 | Ga0068305_10061278 | 3300005083 | Bacteria | 11222 |
| 36 | Ga0072941_1000156 | 3300005201 | Bacteria | 33336 |
| 37 | Ga0466707_033985 | 3300042601 | Bacteria | 3104 |
| 38 | Ga0466720_023132 | 3300042607 | Bacteria | 6990 |
| 39 | Ga0466720_115208 | 3300042607 | Bacteria | 9027 |
| 40 | Ga0466722_198990 | 3300042609 | Bacteria | 9170 |
| 41 | Ga0466735_231137 | 3300042624 | Bacteria | 1428 |
| 42 | Ga0466703_065350 | 3300042636 | Bacteria | 3240 |
| 43 | Ga0466703_326643 | 3300042636 | Bacteria | 4142 |
| 44 | Ga0466709_232006 | 3300042648 | Bacteria | 6324 |
| 45 | Ga0466709_260032 | 3300042648 | Bacteria | 1819 |
| 46 | Ga0466708_165739 | 3300042652 | Bacteria | 3146 |
| 47 | Ga0466727_107260 | 3300042655 | Bacteria | 1593 |
| 48 | Ga0466657_274914 | 3300042582 | Bacteria | 1400 |
| 49 | Ga0466690_159612 | 3300042590 | Bacteria | 15265 |
| 50 | Ga0466692_047928 | 3300042591 | Bacteria | 29037 |
| 51 | Ga0466692_125052 | 3300042591 | Bacteria | 28079 |
| 52 | Ga0466694_112875 | 3300042594 | Bacteria | 3487 |
| 53 | Ga0466699_021017 | 3300042597 | Bacteria | 4766 |
| 54 | Ga0466699_072196 | 3300042597 | Bacteria | 50938 |
| 55 | Ga0123353_10002040 | 3300010167 | Bacteria | 24948 |
| 56 | Ga0123353_10318597 | 3300010167 | Bacteria | 2361 |
| 57 | Ga0466718_133833 | 3300042617 | Unclassified | 3386 |
| 58 | Ga0466723_046855 | 3300042618 | Bacteria | 5924 |
| 59 | Ga0466723_057409 | 3300042618 | Bacteria | 7670 |
| 60 | Ga0466723_151421 | 3300042618 | Bacteria | 5774 |
| 61 | Ga0466723_369714 | 3300042618 | Bacteria | 4578 |
| 62 | JGI24702J35022_10004788 | 3300002462 | Bacteria | 7995 |
| 63 | Ga0466707_005042 | 3300042601 | Bacteria | 3543 |
| 64 | Ga0466719_104197 | 3300042606 | Bacteria | 30611 |
| 65 | Ga0466705_332881 | 3300042612 | Bacteria | 2362 |
| 66 | Ga0466733_150287 | 3300042659 | Bacteria | 12115 |
| 67 | Ga0466703_035869 | 3300042636 | Bacteria | 3683 |
| 68 | Ga0466703_221289 | 3300042636 | Bacteria | 6508 |
| 69 | Ga0466704_516777 | 3300042643 | Bacteria | 12748 |
| 70 | Ga0466708_093297 | 3300042652 | Bacteria | 2880 |
| 71 | Ga0466694_222263 | 3300042594 | Bacteria | 27991 |
| 72 | Ga0466696_302117 | 3300042596 | Bacteria | 3206 |
| 73 | Ga0466696_355841 | 3300042596 | Bacteria | 26852 |
| 74 | Ga0123357_10214334 | 3300009784 | Bacteria | 2154 |
| 75 | Ga0123356_10002032 | 3300010049 | Bacteria | 21840 |
| 76 | Ga0466711_021704 | 3300042615 | Bacteria | 6171 |
| 77 | Ga0466715_645924 | 3300042616 | Bacteria | 10578 |
| 78 | Ga0466718_103405 | 3300042617 | Bacteria | 1250 |
| 79 | JGI24698J34947_10002394 | 3300002449 | Bacteria | 10095 |
| 80 | JGI24702J35022_10038221 | 3300002462 | Bacteria | 2563 |
| 81 | Ga0466716_516700 | 3300042605 | Bacteria | 3518 |
| 82 | Ga0466698_257566 | 3300042610 | Unclassified | 7917 |
| 83 | Ga0466732_036891 | 3300042656 | Bacteria | 25406 |
| 84 | Ga0466703_215039 | 3300042636 | Bacteria | 3746 |
| 85 | Ga0466727_173603 | 3300042655 | Bacteria | 10717 |
| 86 | Ga0466727_239367 | 3300042655 | Bacteria | 1761 |
| 87 | Ga0456237_0001404 | 3300041968 | Bacteria | 3833 |
| 88 | Ga0123356_10251595 | 3300010049 | Bacteria | 1845 |
| 89 | Ga0466718_068515 | 3300042617 | Bacteria | 2631 |
| 90 | Ga0466723_025944 | 3300042618 | Bacteria | 26067 |
| 91 | Ga0466723_184160 | 3300042618 | Bacteria | 1566 |
| 92 | AustNasuHG_c1005232 | 3300000089 | Bacteria | 4637 |
| 93 | JGI24698J34947_10004353 | 3300002449 | Unclassified | 7704 |
| 94 | Ga0466722_031731 | 3300042609 | Unclassified | 2736 |
| 95 | Ga0466735_111122 | 3300042624 | Bacteria | 4306 |
| 96 | Ga0466709_123412 | 3300042648 | Bacteria | 9118 |
| 97 | Ga0466696_112191 | 3300042596 | Bacteria | 3913 |
| 98 | Ga0466696_174839 | 3300042596 | Bacteria | 2442 |
| 99 | Ga0466696_190767 | 3300042596 | Bacteria | 10439 |
| 100 | Ga0466723_107779 | 3300042618 | Bacteria | 6812 |
| 101 | Ga0466726_280886 | 3300042619 | Bacteria | 9449 |
| 102 | Ga0466714_092122 | 3300042603 | Bacteria | 2756 |
| 103 | Ga0466722_100464 | 3300042609 | Bacteria | 1747 |
| 104 | Ga0466732_356472 | 3300042656 | Unclassified | 1972 |
| 105 | Ga0466709_259288 | 3300042648 | Bacteria | 12163 |
| 106 | Ga0466709_368115 | 3300042648 | Bacteria | 3806 |
| 107 | Ga0466708_083956 | 3300042652 | Bacteria | 3525 |
| 108 | Ga0466708_357048 | 3300042652 | Bacteria | 2127 |
| 109 | Ga0415639_103570 | 3300038395 | Bacteria | 5260 |
| 110 | Ga0415639_177906 | 3300038395 | Bacteria | 1825 |
| 111 | Ga0466690_019877 | 3300042590 | Bacteria | 5459 |
| 112 | Ga0123353_10197656 | 3300010167 | Bacteria | 3168 |
| 113 | Ga0466726_066536 | 3300042619 | Bacteria | 4893 |
| 114 | AustNasuHG_c1007557 | 3300000089 | Bacteria | 3859 |
| 115 | JGI24695J34938_10000217 | 3300002450 | Bacteria | 55213 |
| 116 | Ga0466719_221436 | 3300042606 | Bacteria | 5818 |
| 117 | Ga0466720_144023 | 3300042607 | Bacteria | 21010 |
| 118 | Ga0466722_008188 | 3300042609 | Bacteria | 6815 |
| 119 | Ga0466705_058016 | 3300042612 | Bacteria | 2474 |
| 120 | Ga0466704_095616 | 3300042643 | Bacteria | 8898 |
| 121 | Ga0466704_354331 | 3300042643 | Bacteria | 2258 |
| 122 | Ga0466709_051646 | 3300042648 | Bacteria | 6688 |
| 123 | Ga0466708_218307 | 3300042652 | Bacteria | 2786 |
| 124 | Ga0466690_050356 | 3300042590 | Bacteria | 26222 |
| 125 | Ga0466690_357148 | 3300042590 | Bacteria | 13321 |
| 126 | Ga0466691_100547 | 3300042593 | Unclassified | 4208 |
| 127 | Ga0123356_10013697 | 3300010049 | Bacteria | 7813 |
| 128 | Ga0466718_055411 | 3300042617 | Bacteria | 18800 |
| 129 | Ga0466723_078140 | 3300042618 | Bacteria | 6748 |
| 130 | Ga0466726_042204 | 3300042619 | Bacteria | 3591 |
| 131 | Ga0466726_087278 | 3300042619 | Bacteria | 3318 |
| 132 | Ga0466728_006235 | 3300042620 | Bacteria | 3630 |
| 133 | Ga0466728_097927 | 3300042620 | Bacteria | 3622 |
| 134 | JGI24697J35500_11270226 | 3300002507 | Unclassified | 4171 |
| 135 | Ga0466716_102525 | 3300042605 | Bacteria | 18805 |
| 136 | Ga0466716_176156 | 3300042605 | Bacteria | 3904 |
| 137 | Ga0466722_095351 | 3300042609 | Bacteria | 10158 |
| 138 | Ga0466722_125296 | 3300042609 | Bacteria | 8261 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.