Protein Family IF07798
Metagenome
Isolate
152
Members
63
Samples
136
Scaffolds
193.99
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_439319|Ga0466715_439319_3780_4418
- Length
- 212 aa
- Sequence
- LGQLFRADMPLVPQTTNPKPLITNKTMTKSKRCEWCGNDPVYVKYHDEEWGKPVHDDRIMFEFLVLEGAQAGLSWITILKRRENYRKAFAEFDPKKVAKFTEKKVEQLMNNNGIIRNRLKITATISNAQAFLAVQKEFGSFSNFLWSFLPDGKPIVGHWQSWSDIPATTELSDRIAKEMKRRGFKFFGSTICYAHLQATGLVNDHIETCPAK
Sample Types
Isolate
10.5%
Metagenome
89.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
37.3%
Unclassified
22.0%
Kalotermitidae
20.3%
Tenebrionidae
8.5%
Termopsidae
3.4%
Rhinotermitidae
1.7%
Hodotermitidae
1.7%
Passalidae
1.7%
Drosophilidae
1.7%
Scarabaeidae
1.7%
Taxonomy
Archaea
4
Bacteria
136
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 2 | 2882250448 | Bizionia sp. APA-3 | Isolate | |
| 3 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300056814 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE (version 2) | Metagenome | Tenebrionidae |
| 9 | 3300057007 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP_oats (version 2) | Metagenome | Tenebrionidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 12 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 13 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 18 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 19 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 20 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 21 | 2896843662 | Levilactobacillus brevis BDGP6 | Isolate | Drosophilidae |
| 22 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 23 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 24 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 25 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 28 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 32 | 3300012828 | Enriched millipede-associated microbial communities from UW Madison campus, WI, USA - HID1971K_E0 MG | Metagenome | |
| 33 | 3300056790 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_LDPE (version 2) | Metagenome | Tenebrionidae |
| 34 | 3300056856 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_PP (version 2) | Metagenome | Tenebrionidae |
| 35 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 36 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 37 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 38 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 39 | 2634166424 | Clostridium sp. L74 | Isolate | Scarabaeidae |
| 40 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 41 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 42 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 43 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 44 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 45 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 46 | 637000113 | Francisella tularensis tularensis FSC 198 | Isolate | |
| 47 | 8017489919 | Lactobacillus brevis EF | Isolate | Unclassified |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 2622736579 | Desemzia incerta DSM 20581 | Isolate | Unclassified |
| 52 | 2740892557 | Staphylococcus sp. JDR108L-110-1 | Isolate | Unclassified |
| 53 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 54 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 55 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 56 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 57 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 58 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 59 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 60 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 61 | 2773857778 | Unclassified Fibrobacteres Co191P1bin56 | Isolate | Unclassified |
| 62 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 63 | 3300056842 | Mealworm larvae gut microbial communities from Newark, Delaware, USA - Gut-D30_HDPE_oats (version 2) | Metagenome | Tenebrionidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_323591 | 3300042612 | Bacteria | 1740 |
| 2 | Ga0562378_0082 | 3300056814 | Bacteria | 261822 |
| 3 | Ga0466712_003796 | 3300042614 | Bacteria | 14120 |
| 4 | Ga0466699_001621 | 3300042597 | Bacteria | 1640 |
| 5 | Ga0466699_281422 | 3300042597 | Bacteria | 13155 |
| 6 | Ga0466699_402011 | 3300042597 | Bacteria | 1327 |
| 7 | Ga0123353_10644207 | 3300010167 | Bacteria | 1502 |
| 8 | Ga0466714_136719 | 3300042603 | Bacteria | 1267 |
| 9 | Ga0466714_143435 | 3300042603 | Unclassified | 4960 |
| 10 | Ga0466720_059176 | 3300042607 | Bacteria | 22433 |
| 11 | Ga0466720_181849 | 3300042607 | Bacteria | 1362 |
| 12 | Ga0466698_437566 | 3300042610 | Bacteria | 1439 |
| 13 | JGI24698J34947_10050733 | 3300002449 | Bacteria | 2091 |
| 14 | JGI24695J34938_10010037 | 3300002450 | Bacteria | 5221 |
| 15 | JGI24695J34938_10226170 | 3300002450 | Bacteria | 787 |
| 16 | Ga0466715_439319 | 3300042616 | Bacteria | 8937 |
| 17 | Ga0160431_100488 | 3300012828 | Bacteria | 16226 |
| 18 | Ga0415639_034383 | 3300038395 | Bacteria | 3702 |
| 19 | Ga0415639_095175 | 3300038395 | Bacteria | 1960 |
| 20 | Ga0466699_044405 | 3300042597 | Bacteria | 4726 |
| 21 | Ga0466699_056481 | 3300042597 | Archaea | 1754 |
| 22 | Ga0123356_10299775 | 3300010049 | Bacteria | 1712 |
| 23 | Ga0466700_264962 | 3300042600 | Bacteria | 1102 |
| 24 | Ga0466707_061992 | 3300042601 | Bacteria | 54860 |
| 25 | Ga0466716_340895 | 3300042605 | Unclassified | 6312 |
| 26 | Ga0466720_038241 | 3300042607 | Bacteria | 9410 |
| 27 | Ga0466720_072427 | 3300042607 | Bacteria | 7792 |
| 28 | 2227510482 | 2225789004 | Bacteria | 3568 |
| 29 | AustNasuHG_c1000533 | 3300000089 | Bacteria | 13356 |
| 30 | AustNasuHG_c1004822 | 3300000089 | Bacteria | 4832 |
| 31 | JGI24695J34938_10008240 | 3300002450 | Bacteria | 5968 |
| 32 | JGI24695J34938_10029079 | 3300002450 | Bacteria | 2588 |
| 33 | Ga0466703_287108 | 3300042636 | Bacteria | 2686 |
| 34 | Ga0466704_324299 | 3300042643 | Bacteria | 17934 |
| 35 | Ga0466732_359588 | 3300042656 | Bacteria | 9336 |
| 36 | Ga0562375_2350 | 3300056856 | Unclassified | 21430 |
| 37 | Ga0562374_0053 | 3300057007 | Bacteria | 446032 |
| 38 | Ga0562374_2495 | 3300057007 | Unclassified | 15743 |
| 39 | Ga0466726_429374 | 3300042619 | Bacteria | 1002 |
| 40 | Ga0466690_266806 | 3300042590 | Bacteria | 9932 |
| 41 | Ga0466694_014513 | 3300042594 | Bacteria | 1011 |
| 42 | Ga0466696_358472 | 3300042596 | Unclassified | 5285 |
| 43 | Ga0466699_022863 | 3300042597 | Bacteria | 1549 |
| 44 | Ga0466699_029899 | 3300042597 | Bacteria | 1271 |
| 45 | Ga0466699_096333 | 3300042597 | Bacteria | 2169 |
| 46 | Ga0466699_435813 | 3300042597 | Bacteria | 2891 |
| 47 | Ga0123356_10180890 | 3300010049 | Bacteria | 2130 |
| 48 | Ga0123356_11032968 | 3300010049 | Bacteria | 991 |
| 49 | Ga0123353_10034997 | 3300010167 | Bacteria | 7849 |
| 50 | Ga0466700_113570 | 3300042600 | Bacteria | 1862 |
| 51 | Ga0466700_237029 | 3300042600 | Bacteria | 1017 |
| 52 | Ga0466714_065658 | 3300042603 | Bacteria | 2923 |
| 53 | Ga0466717_209629 | 3300042604 | Bacteria | 2360 |
| 54 | Ga0466720_050125 | 3300042607 | Bacteria | 15396 |
| 55 | Ga0466698_208420 | 3300042610 | Bacteria | 14419 |
| 56 | JGI24698J34947_10124396 | 3300002449 | Bacteria | 1113 |
| 57 | JGI24695J34938_10000071 | 3300002450 | Bacteria | 85834 |
| 58 | JGI24695J34938_10002220 | 3300002450 | Bacteria | 15105 |
| 59 | JGI24695J34938_10019114 | 3300002450 | Archaea | 3404 |
| 60 | JGI24695J34938_10026895 | 3300002450 | Bacteria | 2727 |
| 61 | JGI24695J34938_10041193 | 3300002450 | Bacteria | 2075 |
| 62 | JGI24702J35022_10389462 | 3300002462 | Archaea | 840 |
| 63 | Ga0466727_292468 | 3300042655 | Bacteria | 1176 |
| 64 | Ga0466733_029512 | 3300042659 | Bacteria | 1377 |
| 65 | Ga0466718_035668 | 3300042617 | Bacteria | 1867 |
| 66 | Ga0466699_190598 | 3300042597 | Bacteria | 6360 |
| 67 | Ga0123354_10064219 | 3300010882 | Bacteria | 5386 |
| 68 | Ga0466720_050748 | 3300042607 | Bacteria | 48672 |
| 69 | Ga0466698_305850 | 3300042610 | Bacteria | 1767 |
| 70 | JGI24695J34938_10001486 | 3300002450 | Bacteria | 19789 |
| 71 | JGI24695J34938_10001655 | 3300002450 | Bacteria | 18530 |
| 72 | JGI24695J34938_10049720 | 3300002450 | Bacteria | 1842 |
| 73 | JGI24695J34938_10133771 | 3300002450 | Bacteria | 1011 |
| 74 | Ga0466709_357538 | 3300042648 | Bacteria | 1384 |
| 75 | Ga0562379_0801 | 3300056790 | Bacteria | 49967 |
| 76 | Ga0466712_058952 | 3300042614 | Bacteria | 1023 |
| 77 | Ga0466712_079761 | 3300042614 | Bacteria | 1424 |
| 78 | Ga0466718_164497 | 3300042617 | Bacteria | 2443 |
| 79 | Ga0466723_173415 | 3300042618 | Bacteria | 22886 |
| 80 | Ga0415639_017234 | 3300038395 | Bacteria | 2913 |
| 81 | Ga0466691_142162 | 3300042593 | Unclassified | 1150 |
| 82 | Ga0466699_166288 | 3300042597 | Bacteria | 1324 |
| 83 | Ga0466699_191521 | 3300042597 | Bacteria | 2065 |
| 84 | Ga0123356_11328114 | 3300010049 | Bacteria | 882 |
| 85 | Ga0123353_10932647 | 3300010167 | Unclassified | 1177 |
| 86 | JGI24695J34938_10000383 | 3300002450 | Bacteria | 43842 |
| 87 | JGI24695J34938_10001843 | 3300002450 | Bacteria | 17250 |
| 88 | JGI24695J34938_10013271 | 3300002450 | Bacteria | 4333 |
| 89 | JGI24695J34938_10029498 | 3300002450 | Bacteria | 2565 |
| 90 | Ga0072941_1031397 | 3300005201 | Bacteria | 6592 |
| 91 | Ga0466731_202945 | 3300042622 | Archaea | 11397 |
| 92 | Ga0466704_213000 | 3300042643 | Bacteria | 7471 |
| 93 | Ga0466727_345822 | 3300042655 | Bacteria | 2515 |
| 94 | Ga0466726_010928 | 3300042619 | Bacteria | 1545 |
| 95 | Ga0466726_315760 | 3300042619 | Bacteria | 1063 |
| 96 | Ga0466692_104814 | 3300042591 | Bacteria | 8777 |
| 97 | Ga0466706_289137 | 3300042599 | Bacteria | 7301 |
| 98 | Ga0466714_085950 | 3300042603 | Bacteria | 17609 |
| 99 | Ga0466717_146192 | 3300042604 | Bacteria | 1196 |
| 100 | JGI24698J34947_10023434 | 3300002449 | Unclassified | 3304 |
| 101 | JGI24695J34938_10001875 | 3300002450 | Bacteria | 17081 |
| 102 | JGI24695J34938_10071679 | 3300002450 | Bacteria | 1447 |
| 103 | Ga0466727_228238 | 3300042655 | Bacteria | 2275 |
| 104 | Ga0562377_0937 | 3300056842 | Unclassified | 37197 |
| 105 | Ga0466712_034666 | 3300042614 | Bacteria | 27732 |
| 106 | Ga0466712_054267 | 3300042614 | Bacteria | 1192 |
| 107 | Ga0466692_177158 | 3300042591 | Bacteria | 17341 |
| 108 | Ga0466694_271490 | 3300042594 | Bacteria | 2721 |
| 109 | Ga0123357_10505865 | 3300009784 | Bacteria | 999 |
| 110 | Ga0466700_202387 | 3300042600 | Bacteria | 1354 |
| 111 | Ga0466700_482106 | 3300042600 | Bacteria | 1769 |
| 112 | Ga0466720_229832 | 3300042607 | Bacteria | 1154 |
| 113 | AustNasuHG_c1000319 | 3300000089 | Bacteria | 16758 |
| 114 | JGI24698J34947_10005381 | 3300002449 | Bacteria | 7025 |
| 115 | JGI24698J34947_10208889 | 3300002449 | Bacteria | 758 |
| 116 | JGI24695J34938_10000333 | 3300002450 | Bacteria | 46505 |
| 117 | JGI24695J34938_10001187 | 3300002450 | Bacteria | 23128 |
| 118 | JGI24695J34938_10008482 | 3300002450 | Bacteria | 5852 |
| 119 | JGI24702J35022_10111201 | 3300002462 | Bacteria | 1506 |
| 120 | Ga0466727_103042 | 3300042655 | Bacteria | 1318 |
| 121 | Ga0466705_383437 | 3300042612 | Unclassified | 12342 |
| 122 | Ga0562379_0461 | 3300056790 | Bacteria | 84089 |
| 123 | Ga0562377_0136 | 3300056842 | Bacteria | 216882 |
| 124 | Ga0562377_0536 | 3300056842 | Bacteria | 59580 |
| 125 | Ga0466711_006696 | 3300042615 | Bacteria | 3120 |
| 126 | Ga0466690_432467 | 3300042590 | Bacteria | 3290 |
| 127 | Ga0466693_312582 | 3300042592 | Bacteria | 1056 |
| 128 | Ga0466694_176138 | 3300042594 | Bacteria | 2475 |
| 129 | Ga0123353_10314209 | 3300010167 | Bacteria | 2382 |
| 130 | Ga0123353_11093383 | 3300010167 | Bacteria | 1059 |
| 131 | Ga0466719_182777 | 3300042606 | Unclassified | 3541 |
| 132 | JGI24695J34938_10001516 | 3300002450 | Bacteria | 19556 |
| 133 | JGI24695J34938_10007566 | 3300002450 | Bacteria | 6331 |
| 134 | JGI24695J34938_10082157 | 3300002450 | Bacteria | 1330 |
| 135 | JGI24695J34938_10107238 | 3300002450 | Unclassified | 1139 |
| 136 | JGI24702J35022_10098377 | 3300002462 | Bacteria | 1599 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03352 | Adenine_glyco | Methyladenine glycosylase | 35 | 210 | 0.99 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.