Protein Family IF07711

Metagenome Isolate
166 Members
35 Samples
154 Scaffolds
291.52 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_227452|Ga0466715_227452_254_1291
Length
345 aa
Sequence
MSIFDSFAKSLVFSVCVAALKSLYCNILFFYPFFEHWHIYCFNIGKEAEMTTHVKKKRIKKAAPAQTSYDDENVLSIYLKEINKIPLLTREEENHYAQLVRRGDEYARQKLLRANLRFVVNVAKKYQNQGLPLSDLISEGNIGLINAIERFDVTKGYHFISYAVWWIRQAILKAICEKSRMIRLPLNRANELVQIEKVRKHLPFGRGEEYEIREIAKTLNMRAEHVADLINISRELVSLETPVYAEKDSSLLGDFVEDNRYNQPENYVISESLKEDVNTLLTTLSRKEAEIIQYRFGLNGKSPLSLKEIGDRYNLTKERIRQIEKKAVKRLQHPNRSKHLQAYLA

📊 Sample Types

Isolate 7.2%
Metagenome 92.8%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 42.9%
Culicidae 22.9%
Unclassified 14.3%
Rhinotermitidae 8.6%
Termopsidae 8.6%
Termitidae 2.9%

🌳 Taxonomy

Archaea 0
Bacteria 149
Eukaryota 0
Viruses 0
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2964266314 Entomospira nematocera BR208 Isolate Culicidae
2 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
3 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
4 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
5 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2964145936 Entomospira culicis BR149 Isolate Culicidae
8 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
9 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
10 8063587521 Entomospira entomophilus BR193 Isolate Culicidae
11 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
12 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
13 2964144231 Entomospira culicis BR151 Isolate Culicidae
14 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
15 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
16 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
17 8063595521 Entomospira culicis BR149 Isolate Culicidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 2964130733 Entomospira entomophilus BR193 Isolate Culicidae
22 2503904012 Sphaerochaeta coccoides SPN1, DSM 17374 Isolate Kalotermitidae
23 2819990093 Unclassified Spirochaetes Cu122P1bin9 Isolate Unclassified
24 2820016619 Unclassified Spirochaetes Nt197P3bin71 Isolate Unclassified
25 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
26 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 8063589291 Entomospira nematocera BR208 Isolate Culicidae
29 8063597228 Entomospira culicis BR151 Isolate Culicidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2820027804 Unclassified Spirochaetes Lab288P1bin105 Isolate Unclassified
35 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_108346 3300042612 Bacteria 5571
2 Ga0466705_116677 3300042612 Bacteria 17201
3 Ga0466704_514152 3300042643 Bacteria 5458
4 Ga0466704_576940 3300042643 Bacteria 18021
5 Ga0466709_092933 3300042648 Bacteria 51358
6 Ga0466709_222381 3300042648 Bacteria 2774
7 Ga0466709_327618 3300042648 Bacteria 1480
8 Ga0466716_183073 3300042605 Bacteria 2766
9 Ga0466723_087380 3300042618 Bacteria 4092
10 Ga0466723_250122 3300042618 Bacteria 2214
11 Ga0466726_492173 3300042619 Bacteria 9834
12 Ga0466728_236958 3300042620 Bacteria 6386
13 Ga0466728_410848 3300042620 Unclassified 2846
14 Ga0466691_001806 3300042593 Bacteria 16193
15 Ga0466696_128334 3300042596 Bacteria 7354
16 Ga0466705_188300 3300042612 Bacteria 5189
17 Ga0466703_152730 3300042636 Bacteria 13104
18 Ga0466703_172848 3300042636 Unclassified 12739
19 Ga0466704_167319 3300042643 Bacteria 6430
20 Ga0466708_111668 3300042652 Bacteria 2538
21 Ga0466708_415395 3300042652 Bacteria 16096
22 Ga0466727_318938 3300042655 Bacteria 3984
23 Ga0466716_061660 3300042605 Bacteria 2606
24 Ga0466716_485845 3300042605 Bacteria 25844
25 Ga0466719_036843 3300042606 Bacteria 1638
26 Ga0466723_024654 3300042618 Bacteria 62216
27 Ga0466723_100699 3300042618 Bacteria 6025
28 Ga0466726_357311 3300042619 Bacteria 5183
29 Ga0466726_369316 3300042619 Bacteria 1951
30 Ga0123353_10018440 3300010167 Bacteria 10323
31 Ga0466690_292912 3300042590 Bacteria 14234
32 Ga0466690_407367 3300042590 Unclassified 3048
33 Ga0466691_222419 3300042593 Unclassified 3758
34 Ga0466696_041253 3300042596 Bacteria 18008
35 Ga0466696_441267 3300042596 Bacteria 1602
36 Ga0466735_234413 3300042624 Unclassified 1754
37 Ga0466704_114706 3300042643 Bacteria 4032
38 Ga0466709_027574 3300042648 Bacteria 30111
39 Ga0466709_205317 3300042648 Bacteria 10596
40 Ga0466708_088654 3300042652 Bacteria 3117
41 Ga0466708_467939 3300042652 Bacteria 6432
42 Ga0466716_176115 3300042605 Bacteria 8865
43 Ga0466716_344968 3300042605 Bacteria 1386
44 Ga0466719_117677 3300042606 Unclassified 3787
45 Ga0466722_087967 3300042609 Bacteria 10823
46 Ga0466722_148816 3300042609 Bacteria 1126
47 Ga0466722_178510 3300042609 Bacteria 21009
48 Ga0466711_233753 3300042615 Bacteria 1566
49 Ga0466711_393152 3300042615 Bacteria 3714
50 Ga0466715_227452 3300042616 Bacteria 7054
51 Ga0466723_053830 3300042618 Bacteria 8166
52 Ga0456237_0001855 3300041968 Bacteria 3405
53 Ga0466690_266863 3300042590 Bacteria 2307
54 Ga0466691_092776 3300042593 Bacteria 3705
55 Ga0466696_144611 3300042596 Bacteria 3247
56 Ga0466705_099042 3300042612 Bacteria 16689
57 Ga0466703_013414 3300042636 Bacteria 3349
58 Ga0466703_019859 3300042636 Bacteria 10796
59 Ga0466703_226679 3300042636 Bacteria 6329
60 Ga0466704_324521 3300042643 Bacteria 18406
61 Ga0466704_524737 3300042643 Bacteria 1818
62 Ga0466709_260593 3300042648 Unclassified 3791
63 Ga0466719_046534 3300042606 Unclassified 11310
64 Ga0466715_453497 3300042616 Bacteria 1662
65 Ga0466723_078689 3300042618 Unclassified 2753
66 Ga0466723_115607 3300042618 Bacteria 11237
67 Ga0466723_233601 3300042618 Bacteria 20016
68 Ga0466726_079608 3300042619 Bacteria 1360
69 Ga0466726_159421 3300042619 Bacteria 10976
70 Ga0466690_432901 3300042590 Unclassified 2734
71 Ga0466705_007138 3300042612 Bacteria 7794
72 Ga0466705_030067 3300042612 Bacteria 3248
73 Ga0466705_346866 3300042612 Bacteria 7172
74 Ga0466703_013709 3300042636 Bacteria 10298
75 Ga0466704_222483 3300042643 Bacteria 17167
76 Ga0466727_211886 3300042655 Bacteria 1526
77 Ga0466713_111501 3300042602 Bacteria 5151
78 Ga0466719_127081 3300042606 Bacteria 3937
79 Ga0466722_104697 3300042609 Bacteria 8004
80 Ga0466722_202992 3300042609 Bacteria 1145
81 Ga0466722_225650 3300042609 Bacteria 3619
82 Ga0466722_268886 3300042609 Bacteria 6278
83 Ga0466715_494775 3300042616 Bacteria 1493
84 Ga0466723_002650 3300042618 Bacteria 6865
85 Ga0466726_196415 3300042619 Bacteria 2379
86 Ga0466726_435265 3300042619 Bacteria 15603
87 Ga0466726_466852 3300042619 Bacteria 1751
88 Ga0466728_118606 3300042620 Unclassified 2465
89 Ga0466728_332000 3300042620 Bacteria 8301
90 Ga0466690_096257 3300042590 Bacteria 9145
91 Ga0466690_320522 3300042590 Bacteria 5812
92 Ga0466692_050864 3300042591 Bacteria 1614
93 Ga0466691_043505 3300042593 Bacteria 8840
94 Ga0466691_079330 3300042593 Bacteria 18860
95 Ga0466696_353083 3300042596 Bacteria 2085
96 Ga0466705_024062 3300042612 Bacteria 3155
97 Ga0466735_074763 3300042624 Bacteria 14970
98 Ga0466708_158435 3300042652 Bacteria 10344
99 Ga0466708_194474 3300042652 Bacteria 10199
100 Ga0466727_092433 3300042655 Bacteria 40113
101 Ga0466716_165062 3300042605 Bacteria 6155
102 Ga0466716_288081 3300042605 Unclassified 2427
103 Ga0466719_063288 3300042606 Unclassified 4904
104 Ga0466719_302830 3300042606 Bacteria 2855
105 Ga0466711_135449 3300042615 Bacteria 1333
106 Ga0466715_037917 3300042616 Bacteria 1911
107 Ga0466715_405755 3300042616 Bacteria 13194
108 Ga0466723_069225 3300042618 Bacteria 20090
109 Ga0466726_078018 3300042619 Bacteria 1810
110 Ga0466726_182611 3300042619 Bacteria 3663
111 Ga0466726_288580 3300042619 Bacteria 14434
112 Ga0466705_104831 3300042612 Unclassified 5164
113 Ga0466705_223056 3300042612 Bacteria 1425
114 Ga0466735_148671 3300042624 Bacteria 1477
115 Ga0466703_094356 3300042636 Bacteria 13418
116 Ga0466709_092022 3300042648 Bacteria 3056
117 Ga0466709_344763 3300042648 Bacteria 7295
118 Ga0466727_258402 3300042655 Bacteria 1377
119 Ga0466727_267061 3300042655 Bacteria 2437
120 Ga0466716_155028 3300042605 Bacteria 4266
121 Ga0466711_105732 3300042615 Bacteria 9459
122 Ga0466711_494635 3300042615 Bacteria 1164
123 Ga0466711_508261 3300042615 Bacteria 1897
124 Ga0466715_373160 3300042616 Bacteria 3535
125 Ga0466726_287505 3300042619 Bacteria 1983
126 Ga0466726_320800 3300042619 Bacteria 4238
127 Ga0466728_051269 3300042620 Unclassified 5620
128 Ga0466728_422231 3300042620 Bacteria 52940
129 Ga0123353_10598682 3300010167 Bacteria 1576
130 Ga0466690_392966 3300042590 Bacteria 2240
131 Ga0466691_068164 3300042593 Bacteria 14000
132 Ga0466696_070886 3300042596 Bacteria 6865
133 Ga0466735_093737 3300042624 Bacteria 7901
134 Ga0466703_020388 3300042636 Bacteria 11755
135 Ga0466703_232611 3300042636 Bacteria 4765
136 Ga0466704_016291 3300042643 Bacteria 18399
137 Ga0466709_098198 3300042648 Bacteria 3607
138 Ga0466708_046216 3300042652 Bacteria 7045
139 Ga0466708_308576 3300042652 Bacteria 7729
140 Ga0466707_411452 3300042601 Bacteria 3075
141 Ga0466716_057404 3300042605 Bacteria 13927
142 Ga0466711_021525 3300042615 Bacteria 14828
143 Ga0466711_091091 3300042615 Bacteria 4642
144 Ga0466711_192602 3300042615 Bacteria 12297
145 Ga0466711_294028 3300042615 Bacteria 4497
146 Ga0466711_373557 3300042615 Bacteria 3275
147 Ga0466715_269038 3300042616 Bacteria 3613
148 Ga0466723_102058 3300042618 Unclassified 3461
149 Ga0466726_054296 3300042619 Bacteria 2058
150 Ga0466728_385290 3300042620 Bacteria 44462
151 Ga0123353_10151358 3300010167 Unclassified 3704
152 Ga0466692_005590 3300042591 Bacteria 32799
153 Ga0466696_233138 3300042596 Bacteria 2413
154 Ga0466696_359972 3300042596 Bacteria 2233

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF04545 Sigma70_r4 Sigma-70, region 4 281 333 0.97
PF00140 Sigma70_r1_2 Sigma-70 factor, region 1.2 75 105 0.96
PF04542 Sigma70_r2 Sigma-70 region 2 111 178 0.95
PF04539 Sigma70_r3 Sigma-70 region 3 191 267 0.93

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.