Protein Family IF07697

Metagenome Isolate
137 Members
33 Samples
136 Scaffolds
556.21 Avg Length

🧬 Representative Sequence

ID
3300042616|Ga0466715_199076|Ga0466715_199076_5150_6985
Length
611 aa
Sequence
VKTQFFIGFIPIAGFNIPWRAAVKRALKSAGMHSEKPVSPPPAPFRKQPLKALFFFSLFLFSQTLLFPFNFEREGDPEVLAGLLVGEMSDEQALAQTFMLGWVGATPSPLIMDWIRDRNIGGIKIFGWNTGDTLKLAETVGSLQRAALAGAFQIPLLVATDQEGGWIRHVKGATSETPGNMAIGASGYPMDAYWSGFYIGRELAVLGINMNFAPAVDLYTNRDSVLIGPRAFGNDPVRTGILGAAFVKGQQAAGIIATAKHYPGHGDTDLDSHGVLPQIRAPFELLWDRELIPYRLLAREGIPAIMSGHLAFPNTQAGETPASLSSWFLRDILRDRISYQGVIITDDLMMNGATTYAGSLSRAAKQALLAGNDIIMLSKTPNLSDPVWTYLVSSMREEREFRDRVRDAARRVLAVKLEYLRGDKKVSWIPDLKKVEENLPDLEAKAFFLDLAARSVTAIKGDSEASGGGGVFPLSPEKAGKILLAGQFEDFFSVGKIAYPDAVSCWFSSSQGEGELIRYAQNVDTIIFCLSEARDLRSLXXXRSLGKRVIVFSILSPVYLDETAWVDGAIAVYSYAKESFIAGFSMILGRIPAGGRLPFPLNEPRWVSPQG

📊 Sample Types

Isolate 0.7%
Metagenome 99.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 43.8%
Termitidae 34.4%
Unclassified 9.4%
Termopsidae 6.2%
Hodotermitidae 3.1%
Rhinotermitidae 3.1%

🌳 Taxonomy

Archaea 1
Bacteria 127
Eukaryota 0
Viruses 1
Unclassified 8

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
2 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
5 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
6 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
7 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
8 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
11 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
12 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
16 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
17 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
18 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
19 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
20 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
21 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
22 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
23 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
24 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
25 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
26 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
29 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
30 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
31 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
32 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
33 650716102 Treponema primitia ZAS-2 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466704_022603 3300042643 Bacteria 6714
2 Ga0466704_415370 3300042643 Bacteria 4343
3 Ga0466709_019236 3300042648 Bacteria 18315
4 Ga0466708_226169 3300042652 Bacteria 4705
5 Ga0466690_349010 3300042590 Bacteria 4619
6 Ga0466691_031667 3300042593 Bacteria 7103
7 Ga0466691_062260 3300042593 Bacteria 13313
8 Ga0466696_241441 3300042596 Bacteria 21872
9 Ga0466699_379330 3300042597 Bacteria 2022
10 Ga0466713_117863 3300042602 Bacteria 5934
11 Ga0466716_029455 3300042605 Bacteria 9996
12 Ga0466711_008234 3300042615 Bacteria 2428
13 Ga0466711_053634 3300042615 Bacteria 2254
14 Ga0466715_133547 3300042616 Bacteria 8508
15 Ga0466715_415985 3300042616 Bacteria 9046
16 Ga0466723_035249 3300042618 Bacteria 15913
17 Ga0466723_102470 3300042618 Bacteria 10211
18 Ga0466723_233646 3300042618 Unclassified 4915
19 Ga0466728_022104 3300042620 Bacteria 5293
20 Ga0466728_422231 3300042620 Bacteria 52940
21 Ga0466728_434743 3300042620 Bacteria 3243
22 Ga0123357_10270814 3300009784 Bacteria 1775
23 Ga0466708_016347 3300042652 Bacteria 5164
24 Ga0466696_054305 3300042596 Bacteria 3985
25 Ga0466696_266527 3300042596 Bacteria 8331
26 Ga0466707_202066 3300042601 Unclassified 3864
27 Ga0466719_078840 3300042606 Bacteria 12999
28 Ga0466715_106832 3300042616 Bacteria 7404
29 Ga0466715_171770 3300042616 Bacteria 2963
30 Ga0466715_199076 3300042616 Bacteria 12537
31 Ga0466715_317032 3300042616 Bacteria 9183
32 Ga0466723_103493 3300042618 Bacteria 19448
33 Ga0466726_066850 3300042619 Bacteria 2747
34 AustNasuHG_c1019119 3300000089 Bacteria 2253
35 Ga0123353_10011949 3300010167 Bacteria 12282
36 Ga0466703_192749 3300042636 Bacteria 5755
37 Ga0466704_361590 3300042643 Bacteria 3665
38 Ga0466709_158445 3300042648 Bacteria 9470
39 Ga0466708_440807 3300042652 Bacteria 7090
40 Ga0466727_089830 3300042655 Bacteria 3513
41 Ga0466690_227740 3300042590 Bacteria 4682
42 Ga0466694_118208 3300042594 Bacteria 29009
43 Ga0466694_326439 3300042594 Bacteria 9267
44 Ga0466694_376328 3300042594 Bacteria 3843
45 Ga0466716_484300 3300042605 Bacteria 5912
46 Ga0466719_182620 3300042606 Bacteria 8936
47 Ga0466720_014248 3300042607 Bacteria 6565
48 Ga0466715_260645 3300042616 Bacteria 28966
49 Ga0466723_065503 3300042618 Bacteria 10421
50 Ga0466723_373578 3300042618 Bacteria 5010
51 Ga0466728_024495 3300042620 Bacteria 3351
52 Ga0466728_209324 3300042620 Bacteria 14460
53 JGI24702J35022_10025231 3300002462 Bacteria 3209
54 Ga0123353_10106646 3300010167 Bacteria 4514
55 Ga0466705_282676 3300042612 Viruses 2448
56 Ga0466703_091206 3300042636 Bacteria 37744
57 Ga0466703_418956 3300042636 Bacteria 3987
58 Ga0466727_033733 3300042655 Bacteria 14786
59 Ga0466690_182710 3300042590 Bacteria 10208
60 Ga0466691_104204 3300042593 Bacteria 18796
61 Ga0466696_332646 3300042596 Bacteria 7293
62 Ga0466716_087969 3300042605 Bacteria 4182
63 Ga0466719_339917 3300042606 Bacteria 3348
64 Ga0466722_015475 3300042609 Bacteria 2033
65 Ga0466711_324294 3300042615 Bacteria 20953
66 Ga0466715_342951 3300042616 Bacteria 5314
67 Ga0466718_043116 3300042617 Bacteria 2026
68 Ga0466723_221021 3300042618 Bacteria 7076
69 Ga0466723_313594 3300042618 Bacteria 97104
70 Ga0466726_262033 3300042619 Bacteria 2762
71 Ga0466726_264291 3300042619 Bacteria 13165
72 Ga0466705_234599 3300042612 Bacteria 10631
73 Ga0466703_037356 3300042636 Bacteria 2549
74 Ga0466703_157033 3300042636 Bacteria 8624
75 Ga0466703_226166 3300042636 Bacteria 2935
76 Ga0466708_171357 3300042652 Bacteria 10707
77 Ga0466690_096329 3300042590 Unclassified 3263
78 Ga0466719_354697 3300042606 Bacteria 16235
79 Ga0466712_058984 3300042614 Bacteria 8466
80 Ga0466715_430360 3300042616 Bacteria 1902
81 Ga0466723_260044 3300042618 Unclassified 10323
82 Ga0466723_345353 3300042618 Bacteria 13151
83 Ga0466728_150306 3300042620 Bacteria 6544
84 Ga0466728_229743 3300042620 Bacteria 5628
85 Ga0466705_263844 3300042612 Bacteria 6365
86 Ga0466704_084255 3300042643 Bacteria 4246
87 Ga0466709_353343 3300042648 Bacteria 4806
88 Ga0466727_265252 3300042655 Bacteria 2086
89 Ga0466690_096563 3300042590 Bacteria 16112
90 Ga0466706_135950 3300042599 Bacteria 25271
91 Ga0466700_022121 3300042600 Unclassified 2398
92 Ga0466722_238461 3300042609 Bacteria 6008
93 Ga0466711_048571 3300042615 Bacteria 3603
94 Ga0466711_099974 3300042615 Bacteria 18492
95 Ga0466715_195427 3300042616 Bacteria 3145
96 Ga0466715_534073 3300042616 Bacteria 5493
97 Ga0466726_100679 3300042619 Bacteria 2498
98 Ga0466726_261125 3300042619 Bacteria 14026
99 Ga0466705_067441 3300042612 Unclassified 8174
100 Ga0466709_013258 3300042648 Unclassified 5342
101 Ga0466709_083873 3300042648 Bacteria 13811
102 Ga0466709_118393 3300042648 Bacteria 3143
103 Ga0466709_378031 3300042648 Bacteria 3160
104 Ga0466708_038124 3300042652 Bacteria 2675
105 Ga0466708_114752 3300042652 Bacteria 3629
106 Ga0264413_123840 3300024493 Bacteria 7672
107 Ga0466690_286348 3300042590 Bacteria 8069
108 Ga0466691_006909 3300042593 Bacteria 3745
109 Ga0466696_027217 3300042596 Bacteria 13020
110 Ga0466716_145772 3300042605 Bacteria 4682
111 Ga0466719_052414 3300042606 Bacteria 13658
112 Ga0466705_419960 3300042612 Bacteria 5307
113 Ga0466723_374201 3300042618 Bacteria 3670
114 Ga0466726_148020 3300042619 Bacteria 6033
115 Ga0466726_396360 3300042619 Bacteria 7444
116 Ga0466705_168935 3300042612 Bacteria 6471
117 Ga0466702_177076 3300042635 Bacteria 26172
118 Ga0466703_066311 3300042636 Bacteria 23126
119 Ga0466704_086985 3300042643 Unclassified 3866
120 Ga0466709_141905 3300042648 Bacteria 8632
121 Ga0466708_217097 3300042652 Bacteria 13274
122 Ga0466690_117105 3300042590 Bacteria 5022
123 Ga0466691_227804 3300042593 Archaea 3391
124 Ga0466716_283160 3300042605 Bacteria 7797
125 Ga0466719_041107 3300042606 Bacteria 9469
126 Ga0466719_054319 3300042606 Bacteria 5603
127 Ga0466719_266929 3300042606 Bacteria 24531
128 Ga0466722_200037 3300042609 Bacteria 9330
129 Ga0466705_392190 3300042612 Bacteria 3730
130 Ga0466705_435350 3300042612 Bacteria 3411
131 Ga0466711_305512 3300042615 Bacteria 13938
132 Ga0466711_506876 3300042615 Bacteria 6634
133 Ga0466715_335419 3300042616 Bacteria 4022
134 Ga0466723_034802 3300042618 Bacteria 4711
135 Ga0466728_110388 3300042620 Bacteria 15030
136 Ga0466728_311772 3300042620 Bacteria 5159

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00933 Glyco_hydro_3 Glycosyl hydrolase family 3 N terminal domain 106 414 0.94

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.