Protein Family IF07664
Metagenome
Isolate
145
Members
38
Samples
141
Scaffolds
88.31
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_114864|Ga0466715_114864_5065_5340
- Length
- 81 aa
- Sequence
- LKVSIGDVTSLLRGGILQVLILAAPLLVSIQATTSIQEQTLTFVPKVLAILLILALLGGWMFSSLRDYTIELFRMIPDMVR
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
24.3%
Unclassified
16.2%
Termopsidae
10.8%
Rhinotermitidae
8.1%
Hodotermitidae
2.7%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 4 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 5 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 6 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 7 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 8 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 15 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 16 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 17 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 18 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 19 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 26 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 27 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 28 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 29 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 30 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 31 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 32 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 33 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466719_060078 | 3300042606 | Unclassified | 1077 |
| 2 | Ga0466722_016582 | 3300042609 | Bacteria | 30884 |
| 3 | JGI24702J35022_10458039 | 3300002462 | Bacteria | 777 |
| 4 | Ga0466711_448800 | 3300042615 | Bacteria | 6793 |
| 5 | Ga0466726_037884 | 3300042619 | Bacteria | 4125 |
| 6 | Ga0466726_218153 | 3300042619 | Bacteria | 1039 |
| 7 | Ga0466726_234056 | 3300042619 | Bacteria | 2007 |
| 8 | Ga0466726_310436 | 3300042619 | Bacteria | 6615 |
| 9 | Ga0466705_362882 | 3300042612 | Bacteria | 8490 |
| 10 | Ga0466703_201432 | 3300042636 | Bacteria | 1032 |
| 11 | Ga0466704_179109 | 3300042643 | Bacteria | 1727 |
| 12 | Ga0466704_362517 | 3300042643 | Bacteria | 10597 |
| 13 | Ga0466708_229267 | 3300042652 | Bacteria | 22598 |
| 14 | Ga0466707_183476 | 3300042601 | Bacteria | 1236 |
| 15 | Ga0466716_065220 | 3300042605 | Bacteria | 2531 |
| 16 | Ga0466692_025321 | 3300042591 | Bacteria | 2306 |
| 17 | Ga0466691_089834 | 3300042593 | Bacteria | 2370 |
| 18 | Ga0466691_098735 | 3300042593 | Bacteria | 8333 |
| 19 | Ga0466691_111082 | 3300042593 | Unclassified | 5515 |
| 20 | Ga0466691_217417 | 3300042593 | Bacteria | 1822 |
| 21 | Ga0466711_209529 | 3300042615 | Bacteria | 13626 |
| 22 | Ga0466711_406506 | 3300042615 | Bacteria | 4102 |
| 23 | Ga0466715_073896 | 3300042616 | Unclassified | 1067 |
| 24 | Ga0466718_006826 | 3300042617 | Bacteria | 2699 |
| 25 | Ga0466718_014855 | 3300042617 | Unclassified | 1142 |
| 26 | Ga0466723_056395 | 3300042618 | Bacteria | 12956 |
| 27 | Ga0466726_147541 | 3300042619 | Bacteria | 36898 |
| 28 | Ga0466726_382659 | 3300042619 | Bacteria | 18394 |
| 29 | Ga0466728_184717 | 3300042620 | Bacteria | 25131 |
| 30 | Ga0466705_275635 | 3300042612 | Bacteria | 7682 |
| 31 | Ga0466703_093404 | 3300042636 | Bacteria | 3125 |
| 32 | Ga0466704_029855 | 3300042643 | Bacteria | 11983 |
| 33 | Ga0466704_250976 | 3300042643 | Unclassified | 1133 |
| 34 | Ga0466708_300076 | 3300042652 | Bacteria | 15030 |
| 35 | Ga0466727_130334 | 3300042655 | Bacteria | 1385 |
| 36 | Ga0466716_146830 | 3300042605 | Unclassified | 2404 |
| 37 | Ga0466691_148146 | 3300042593 | Bacteria | 1711 |
| 38 | JGI24702J35022_10146730 | 3300002462 | Bacteria | 1321 |
| 39 | Ga0068302_10027862 | 3300005071 | Bacteria | 2337 |
| 40 | Ga0466711_008196 | 3300042615 | Bacteria | 13342 |
| 41 | Ga0466715_182132 | 3300042616 | Bacteria | 21512 |
| 42 | Ga0466703_406009 | 3300042636 | Bacteria | 3851 |
| 43 | Ga0466704_060133 | 3300042643 | Unclassified | 1244 |
| 44 | Ga0466704_379885 | 3300042643 | Bacteria | 13731 |
| 45 | Ga0466709_140621 | 3300042648 | Bacteria | 2288 |
| 46 | Ga0466708_461525 | 3300042652 | Bacteria | 8341 |
| 47 | Ga0466722_064604 | 3300042609 | Bacteria | 35013 |
| 48 | Ga0466690_024047 | 3300042590 | Bacteria | 5243 |
| 49 | Ga0466690_381524 | 3300042590 | Unclassified | 6373 |
| 50 | Ga0466691_063358 | 3300042593 | Bacteria | 23082 |
| 51 | AustNasuHG_c1012564 | 3300000089 | Bacteria | 2923 |
| 52 | AustNasuHG_c1060800 | 3300000089 | Unclassified | 732 |
| 53 | JGI24702J35022_10112228 | 3300002462 | Bacteria | 1499 |
| 54 | Ga0072941_1115449 | 3300005201 | Bacteria | 738 |
| 55 | Ga0466711_392657 | 3300042615 | Bacteria | 1838 |
| 56 | Ga0466726_225592 | 3300042619 | Bacteria | 1147 |
| 57 | Ga0466726_306182 | 3300042619 | Unclassified | 1000 |
| 58 | Ga0466726_426338 | 3300042619 | Unclassified | 1156 |
| 59 | Ga0466703_190468 | 3300042636 | Unclassified | 3254 |
| 60 | Ga0466704_181685 | 3300042643 | Bacteria | 6409 |
| 61 | Ga0466709_292735 | 3300042648 | Bacteria | 2091 |
| 62 | Ga0466708_300072 | 3300042652 | Bacteria | 2345 |
| 63 | Ga0466708_341873 | 3300042652 | Bacteria | 2171 |
| 64 | Ga0466708_450512 | 3300042652 | Bacteria | 2483 |
| 65 | Ga0466717_218554 | 3300042604 | Bacteria | 3713 |
| 66 | Ga0466722_093353 | 3300042609 | Bacteria | 7478 |
| 67 | Ga0466691_072438 | 3300042593 | Bacteria | 19896 |
| 68 | Ga0466691_127646 | 3300042593 | Bacteria | 19429 |
| 69 | Ga0466694_125142 | 3300042594 | Bacteria | 2013 |
| 70 | Ga0466696_460146 | 3300042596 | Bacteria | 25654 |
| 71 | Ga0068302_10016028 | 3300005071 | Bacteria | 1606 |
| 72 | Ga0068305_10004744 | 3300005083 | Bacteria | 2418 |
| 73 | Ga0466715_114864 | 3300042616 | Bacteria | 21180 |
| 74 | Ga0466715_227993 | 3300042616 | Bacteria | 17365 |
| 75 | Ga0466715_617762 | 3300042616 | Bacteria | 34643 |
| 76 | Ga0466723_005453 | 3300042618 | Bacteria | 2463 |
| 77 | Ga0466726_152538 | 3300042619 | Bacteria | 1471 |
| 78 | Ga0466726_260004 | 3300042619 | Bacteria | 1518 |
| 79 | Ga0466705_201714 | 3300042612 | Bacteria | 11942 |
| 80 | Ga0466703_093804 | 3300042636 | Bacteria | 20660 |
| 81 | Ga0466704_186002 | 3300042643 | Bacteria | 15772 |
| 82 | Ga0466709_133062 | 3300042648 | Bacteria | 8143 |
| 83 | Ga0466727_029916 | 3300042655 | Bacteria | 1769 |
| 84 | Ga0466727_221336 | 3300042655 | Unclassified | 1084 |
| 85 | Ga0466706_248545 | 3300042599 | Bacteria | 2082 |
| 86 | Ga0466707_184989 | 3300042601 | Bacteria | 1183 |
| 87 | Ga0466716_289947 | 3300042605 | Bacteria | 19027 |
| 88 | Ga0466716_548705 | 3300042605 | Bacteria | 9079 |
| 89 | Ga0466690_128699 | 3300042590 | Bacteria | 3763 |
| 90 | Ga0466692_064738 | 3300042591 | Bacteria | 3279 |
| 91 | Ga0123357_10123189 | 3300009784 | Bacteria | 3257 |
| 92 | Ga0123356_10127911 | 3300010049 | Bacteria | 2483 |
| 93 | Ga0466726_014068 | 3300042619 | Bacteria | 2583 |
| 94 | Ga0466726_080330 | 3300042619 | Bacteria | 1462 |
| 95 | Ga0466726_197857 | 3300042619 | Unclassified | 2790 |
| 96 | Ga0466726_410744 | 3300042619 | Unclassified | 1075 |
| 97 | Ga0466705_294121 | 3300042612 | Unclassified | 1779 |
| 98 | Ga0466703_148587 | 3300042636 | Bacteria | 2377 |
| 99 | Ga0466708_214378 | 3300042652 | Bacteria | 1218 |
| 100 | Ga0466727_106836 | 3300042655 | Bacteria | 3565 |
| 101 | Ga0466727_132155 | 3300042655 | Bacteria | 1120 |
| 102 | Ga0466727_211334 | 3300042655 | Unclassified | 2509 |
| 103 | Ga0466727_338963 | 3300042655 | Unclassified | 1054 |
| 104 | Ga0466717_221316 | 3300042604 | Bacteria | 1566 |
| 105 | Ga0466719_083073 | 3300042606 | Bacteria | 42335 |
| 106 | Ga0466719_511511 | 3300042606 | Bacteria | 1427 |
| 107 | Ga0466722_009932 | 3300042609 | Bacteria | 19464 |
| 108 | Ga0466722_056550 | 3300042609 | Bacteria | 14567 |
| 109 | Ga0466690_398907 | 3300042590 | Bacteria | 5100 |
| 110 | Ga0466691_156091 | 3300042593 | Bacteria | 30300 |
| 111 | Ga0466696_077502 | 3300042596 | Bacteria | 8017 |
| 112 | Ga0466732_242187 | 3300042656 | Bacteria | 1624 |
| 113 | AustNasuHG_c1016366 | 3300000089 | Bacteria | 2483 |
| 114 | Ga0466705_518424 | 3300042612 | Bacteria | 2858 |
| 115 | Ga0466715_185691 | 3300042616 | Bacteria | 8464 |
| 116 | Ga0466726_465982 | 3300042619 | Bacteria | 1235 |
| 117 | Ga0466705_161647 | 3300042612 | Unclassified | 7707 |
| 118 | Ga0466729_234623 | 3300042621 | Bacteria | 1055 |
| 119 | Ga0466704_057074 | 3300042643 | Bacteria | 7757 |
| 120 | Ga0466704_172404 | 3300042643 | Bacteria | 1693 |
| 121 | Ga0466690_145759 | 3300042590 | Bacteria | 14180 |
| 122 | Ga0466696_043616 | 3300042596 | Bacteria | 14161 |
| 123 | Ga0466696_412831 | 3300042596 | Bacteria | 1001 |
| 124 | JGI24695J34938_10000689 | 3300002450 | Bacteria | 31877 |
| 125 | Ga0466705_471085 | 3300042612 | Bacteria | 3488 |
| 126 | Ga0466711_049572 | 3300042615 | Bacteria | 32036 |
| 127 | Ga0466715_570646 | 3300042616 | Unclassified | 6828 |
| 128 | Ga0466723_013333 | 3300042618 | Bacteria | 24235 |
| 129 | Ga0466726_399211 | 3300042619 | Bacteria | 1016 |
| 130 | Ga0466728_320125 | 3300042620 | Bacteria | 4336 |
| 131 | Ga0466735_045053 | 3300042624 | Bacteria | 16196 |
| 132 | Ga0466703_036281 | 3300042636 | Bacteria | 17638 |
| 133 | Ga0466703_100138 | 3300042636 | Bacteria | 36780 |
| 134 | Ga0466703_118252 | 3300042636 | Bacteria | 7147 |
| 135 | Ga0466703_330108 | 3300042636 | Bacteria | 33404 |
| 136 | Ga0466704_105239 | 3300042643 | Bacteria | 15636 |
| 137 | Ga0466709_083805 | 3300042648 | Bacteria | 22572 |
| 138 | Ga0466709_258556 | 3300042648 | Bacteria | 37873 |
| 139 | Ga0466708_041843 | 3300042652 | Bacteria | 23218 |
| 140 | Ga0466708_148678 | 3300042652 | Bacteria | 2565 |
| 141 | Ga0466708_276820 | 3300042652 | Unclassified | 1018 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01313 | Bac_export_3 | Bacterial export proteins, family 3 | 15 | 69 | 0.86 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.