Protein Family IF07638
Metagenome
Isolate
220
Members
49
Samples
214
Scaffolds
354.56
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_072459|Ga0466715_072459_339_1586
- Length
- 415 aa
- Sequence
- MNITVDCRAIGNSGVGVYLRGCLPFFLASSHQFTLLGDRETILASLPGEALRQGKAEFLPCGIKTFSVKELFFFPAPLKRKINKTDIYYSPFFNIPGGIKIPVYCTIHDIVFPDMPELTSKAGLMVRMFFFRRAVKRSKKVFTVSSFSRSRIQHYFGGTIPVIVTYSALQPFFFEPSGDPCQKSKTIVFIGNIKKHKGLNDLLEAFLLARKEGLSHKLIIIGEEKDFRTADSESLKRMNDIGASMVEFTGRLDNESLKRFISRASLLVQPSLYEGFGLPPLEAMALGTKALISDIPVFREIYAGFPVAFFQAGNVRDLKNKLMELLFNQMPETLKLSPELSERYSFKKTSGIVLKEITIQPGSGFAATSPAKPRFGGFLRGFLLNEGVYTPSARKKPRFYFALPPLSWHWHIAAE
Sample Types
Isolate
2.7%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.3%
Kalotermitidae
29.8%
Unclassified
14.9%
Termopsidae
8.5%
Rhinotermitidae
6.4%
Blaberidae
2.1%
Taxonomy
Archaea
2
Bacteria
204
Eukaryota
0
Viruses
0
Unclassified
14
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 10 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 11 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 24 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 34 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 37 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 38 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 39 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 40 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 41 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 47 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 48 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 49 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10252391 | 3300010049 | Bacteria | 1842 |
| 2 | Ga0466712_134403 | 3300042614 | Bacteria | 18494 |
| 3 | Ga0466711_012627 | 3300042615 | Bacteria | 16808 |
| 4 | Ga0466711_124600 | 3300042615 | Bacteria | 33924 |
| 5 | Ga0466715_011664 | 3300042616 | Bacteria | 6679 |
| 6 | Ga0466718_029813 | 3300042617 | Bacteria | 16333 |
| 7 | Ga0466718_036685 | 3300042617 | Bacteria | 20442 |
| 8 | Ga0466718_115546 | 3300042617 | Bacteria | 5492 |
| 9 | Ga0466718_129624 | 3300042617 | Unclassified | 5677 |
| 10 | Ga0466723_046567 | 3300042618 | Unclassified | 1269 |
| 11 | Ga0466726_430132 | 3300042619 | Bacteria | 1241 |
| 12 | Ga0466719_106973 | 3300042606 | Bacteria | 29739 |
| 13 | Ga0466720_078980 | 3300042607 | Bacteria | 9261 |
| 14 | Ga0466720_100415 | 3300042607 | Bacteria | 36539 |
| 15 | Ga0466720_190465 | 3300042607 | Bacteria | 3902 |
| 16 | Ga0068305_10002349 | 3300005083 | Bacteria | 3118 |
| 17 | Ga0072940_1011213 | 3300005200 | Bacteria | 15900 |
| 18 | Ga0072940_1025539 | 3300005200 | Bacteria | 4404 |
| 19 | Ga0072940_1105775 | 3300005200 | Bacteria | 3299 |
| 20 | Ga0072941_1036973 | 3300005201 | Bacteria | 6983 |
| 21 | Ga0264413_102434 | 3300024493 | Bacteria | 6935 |
| 22 | Ga0466690_092360 | 3300042590 | Bacteria | 12914 |
| 23 | Ga0466690_428376 | 3300042590 | Bacteria | 2119 |
| 24 | Ga0466692_059088 | 3300042591 | Bacteria | 2936 |
| 25 | Ga0466692_104444 | 3300042591 | Bacteria | 2809 |
| 26 | Ga0466693_343578 | 3300042592 | Bacteria | 18737 |
| 27 | Ga0466694_231182 | 3300042594 | Bacteria | 6356 |
| 28 | Ga0466694_354846 | 3300042594 | Bacteria | 5939 |
| 29 | Ga0466703_334224 | 3300042636 | Bacteria | 2120 |
| 30 | Ga0466704_108328 | 3300042643 | Bacteria | 14496 |
| 31 | Ga0466704_140178 | 3300042643 | Bacteria | 60046 |
| 32 | Ga0466708_153665 | 3300042652 | Bacteria | 9204 |
| 33 | Ga0466715_102568 | 3300042616 | Bacteria | 13409 |
| 34 | Ga0466718_025890 | 3300042617 | Bacteria | 19672 |
| 35 | Ga0466718_089286 | 3300042617 | Bacteria | 6803 |
| 36 | Ga0466718_169172 | 3300042617 | Bacteria | 6779 |
| 37 | Ga0466723_051597 | 3300042618 | Bacteria | 3059 |
| 38 | Ga0466723_296024 | 3300042618 | Bacteria | 6069 |
| 39 | Ga0466726_036784 | 3300042619 | Bacteria | 2511 |
| 40 | Ga0466726_435341 | 3300042619 | Bacteria | 4094 |
| 41 | Ga0466728_026927 | 3300042620 | Bacteria | 3111 |
| 42 | Ga0466728_079530 | 3300042620 | Bacteria | 21530 |
| 43 | Ga0466720_021975 | 3300042607 | Bacteria | 22180 |
| 44 | Ga0466720_099020 | 3300042607 | Bacteria | 25644 |
| 45 | Ga0466720_211375 | 3300042607 | Bacteria | 60841 |
| 46 | AustNasuHG_c1004708 | 3300000089 | Bacteria | 4892 |
| 47 | JGI24695J34938_10000355 | 3300002450 | Bacteria | 45167 |
| 48 | Ga0068302_10555274 | 3300005071 | Bacteria | 2423 |
| 49 | Ga0264413_112832 | 3300024493 | Unclassified | 3609 |
| 50 | Ga0456237_0000963 | 3300041968 | Bacteria | 4537 |
| 51 | Ga0466690_094406 | 3300042590 | Bacteria | 1962 |
| 52 | Ga0466692_028277 | 3300042591 | Bacteria | 19469 |
| 53 | Ga0466691_060113 | 3300042593 | Bacteria | 13559 |
| 54 | Ga0466694_071384 | 3300042594 | Bacteria | 50432 |
| 55 | Ga0466694_125782 | 3300042594 | Bacteria | 25946 |
| 56 | Ga0466694_400783 | 3300042594 | Bacteria | 7583 |
| 57 | Ga0466699_047467 | 3300042597 | Bacteria | 11573 |
| 58 | Ga0466699_406412 | 3300042597 | Bacteria | 5995 |
| 59 | Ga0466703_316619 | 3300042636 | Bacteria | 5483 |
| 60 | Ga0466704_107068 | 3300042643 | Bacteria | 5127 |
| 61 | Ga0466708_197801 | 3300042652 | Bacteria | 11963 |
| 62 | Ga0466705_266113 | 3300042612 | Bacteria | 67009 |
| 63 | Ga0123356_10003418 | 3300010049 | Bacteria | 16637 |
| 64 | Ga0123353_10072248 | 3300010167 | Bacteria | 5544 |
| 65 | Ga0466712_014319 | 3300042614 | Bacteria | 13934 |
| 66 | Ga0466715_072459 | 3300042616 | Bacteria | 1976 |
| 67 | Ga0466718_006336 | 3300042617 | Bacteria | 6262 |
| 68 | Ga0466718_162500 | 3300042617 | Bacteria | 6383 |
| 69 | Ga0466723_031805 | 3300042618 | Bacteria | 21552 |
| 70 | Ga0466723_303454 | 3300042618 | Bacteria | 32258 |
| 71 | Ga0466726_108366 | 3300042619 | Bacteria | 4928 |
| 72 | Ga0466728_380881 | 3300042620 | Bacteria | 39953 |
| 73 | Ga0466719_077112 | 3300042606 | Bacteria | 68925 |
| 74 | Ga0466720_021630 | 3300042607 | Bacteria | 14229 |
| 75 | Ga0466720_041453 | 3300042607 | Bacteria | 36391 |
| 76 | JGI24698J34947_10037371 | 3300002449 | Bacteria | 2523 |
| 77 | Ga0072941_1032823 | 3300005201 | Bacteria | 7773 |
| 78 | Ga0072941_1044160 | 3300005201 | Bacteria | 8911 |
| 79 | Ga0072941_1083867 | 3300005201 | Bacteria | 4409 |
| 80 | Ga0264413_101011 | 3300024493 | Bacteria | 11928 |
| 81 | Ga0264413_112836 | 3300024493 | Bacteria | 2446 |
| 82 | Ga0466691_025139 | 3300042593 | Bacteria | 13400 |
| 83 | Ga0466696_113527 | 3300042596 | Bacteria | 7167 |
| 84 | Ga0466699_430748 | 3300042597 | Bacteria | 5883 |
| 85 | Ga0466735_111791 | 3300042624 | Bacteria | 6364 |
| 86 | Ga0466735_191018 | 3300042624 | Bacteria | 3220 |
| 87 | Ga0466703_060311 | 3300042636 | Bacteria | 7814 |
| 88 | Ga0466703_156433 | 3300042636 | Bacteria | 10045 |
| 89 | Ga0466704_113408 | 3300042643 | Bacteria | 8894 |
| 90 | Ga0466704_134435 | 3300042643 | Bacteria | 44988 |
| 91 | Ga0123353_10252545 | 3300010167 | Bacteria | 2730 |
| 92 | Ga0466712_158108 | 3300042614 | Bacteria | 28019 |
| 93 | Ga0466711_213916 | 3300042615 | Bacteria | 3303 |
| 94 | Ga0466715_067416 | 3300042616 | Bacteria | 21033 |
| 95 | Ga0466715_089505 | 3300042616 | Bacteria | 7392 |
| 96 | Ga0466718_013201 | 3300042617 | Bacteria | 3994 |
| 97 | Ga0466723_037597 | 3300042618 | Unclassified | 1948 |
| 98 | Ga0466723_360442 | 3300042618 | Bacteria | 1617 |
| 99 | Ga0466726_419944 | 3300042619 | Bacteria | 1355 |
| 100 | Ga0466720_010554 | 3300042607 | Bacteria | 31855 |
| 101 | Ga0466720_178419 | 3300042607 | Bacteria | 5234 |
| 102 | AustNasuHG_c1002278 | 3300000089 | Bacteria | 6932 |
| 103 | AustNasuHG_c1002839 | 3300000089 | Bacteria | 6257 |
| 104 | AustNasuHG_c1002934 | 3300000089 | Bacteria | 6142 |
| 105 | JGI24695J34938_10009239 | 3300002450 | Bacteria | 5499 |
| 106 | Ga0072941_1036072 | 3300005201 | Bacteria | 7680 |
| 107 | Ga0264413_104712 | 3300024493 | Bacteria | 9960 |
| 108 | Ga0264413_112831 | 3300024493 | Bacteria | 4001 |
| 109 | Ga0264413_116334 | 3300024493 | Unclassified | 3646 |
| 110 | Ga0466692_017073 | 3300042591 | Bacteria | 5923 |
| 111 | Ga0466691_022042 | 3300042593 | Bacteria | 10751 |
| 112 | Ga0466691_170012 | 3300042593 | Bacteria | 38393 |
| 113 | Ga0466699_401530 | 3300042597 | Bacteria | 11190 |
| 114 | Ga0466735_144152 | 3300042624 | Bacteria | 15994 |
| 115 | Ga0466704_154549 | 3300042643 | Bacteria | 24370 |
| 116 | Ga0466704_177708 | 3300042643 | Bacteria | 3514 |
| 117 | Ga0466727_186408 | 3300042655 | Bacteria | 4795 |
| 118 | Ga0466727_314238 | 3300042655 | Bacteria | 4333 |
| 119 | Ga0466727_314759 | 3300042655 | Bacteria | 2903 |
| 120 | Ga0466705_193582 | 3300042612 | Bacteria | 8264 |
| 121 | Ga0123356_10000062 | 3300010049 | Bacteria | 112695 |
| 122 | Ga0466715_489021 | 3300042616 | Bacteria | 34263 |
| 123 | Ga0466723_058408 | 3300042618 | Bacteria | 16743 |
| 124 | Ga0466700_206491 | 3300042600 | Bacteria | 1211 |
| 125 | Ga0466716_052445 | 3300042605 | Bacteria | 11987 |
| 126 | Ga0466719_063307 | 3300042606 | Bacteria | 5020 |
| 127 | Ga0466720_028491 | 3300042607 | Bacteria | 76920 |
| 128 | Ga0466720_146320 | 3300042607 | Bacteria | 7439 |
| 129 | Ga0072941_1003147 | 3300005201 | Bacteria | 83880 |
| 130 | Ga0466692_061195 | 3300042591 | Bacteria | 10800 |
| 131 | Ga0466692_083406 | 3300042591 | Bacteria | 20636 |
| 132 | Ga0466699_084084 | 3300042597 | Bacteria | 21187 |
| 133 | Ga0466703_108005 | 3300042636 | Bacteria | 23863 |
| 134 | Ga0466704_207692 | 3300042643 | Bacteria | 1878 |
| 135 | Ga0466705_014035 | 3300042612 | Bacteria | 13151 |
| 136 | Ga0466705_044413 | 3300042612 | Bacteria | 2923 |
| 137 | Ga0123354_10193854 | 3300010882 | Unclassified | 2263 |
| 138 | Ga0466712_174528 | 3300042614 | Bacteria | 22450 |
| 139 | Ga0466712_308114 | 3300042614 | Bacteria | 5143 |
| 140 | Ga0466718_030700 | 3300042617 | Bacteria | 5568 |
| 141 | Ga0466723_260220 | 3300042618 | Unclassified | 3471 |
| 142 | Ga0466723_287526 | 3300042618 | Bacteria | 4674 |
| 143 | Ga0466723_292570 | 3300042618 | Bacteria | 2670 |
| 144 | Ga0466728_003555 | 3300042620 | Bacteria | 15475 |
| 145 | Ga0466728_095239 | 3300042620 | Bacteria | 2063 |
| 146 | Ga0466700_032644 | 3300042600 | Bacteria | 10142 |
| 147 | Ga0466719_132470 | 3300042606 | Bacteria | 7097 |
| 148 | Ga0466720_043999 | 3300042607 | Bacteria | 22878 |
| 149 | Ga0466720_169943 | 3300042607 | Bacteria | 7517 |
| 150 | JGI24695J34938_10000006 | 3300002450 | Bacteria | 141807 |
| 151 | JGI24695J34938_10000511 | 3300002450 | Bacteria | 37801 |
| 152 | JGI24695J34938_10003860 | 3300002450 | Bacteria | 10159 |
| 153 | JGI24695J34938_10007305 | 3300002450 | Bacteria | 6496 |
| 154 | JGI24695J34938_10007984 | 3300002450 | Bacteria | 6105 |
| 155 | JGI24702J35022_10000136 | 3300002462 | Bacteria | 36676 |
| 156 | Ga0068305_10003395 | 3300005083 | Bacteria | 7081 |
| 157 | Ga0264413_104713 | 3300024493 | Bacteria | 35389 |
| 158 | Ga0466690_070949 | 3300042590 | Bacteria | 4625 |
| 159 | Ga0466690_192094 | 3300042590 | Unclassified | 1399 |
| 160 | Ga0466692_053953 | 3300042591 | Archaea | 2526 |
| 161 | Ga0466691_115131 | 3300042593 | Bacteria | 14787 |
| 162 | Ga0466727_167638 | 3300042655 | Bacteria | 1698 |
| 163 | Ga0466705_059011 | 3300042612 | Bacteria | 2635 |
| 164 | Ga0466705_093800 | 3300042612 | Bacteria | 9040 |
| 165 | Ga0123356_10094721 | 3300010049 | Bacteria | 2852 |
| 166 | Ga0466705_422400 | 3300042612 | Bacteria | 19214 |
| 167 | Ga0466712_066823 | 3300042614 | Bacteria | 4785 |
| 168 | Ga0466718_058641 | 3300042617 | Bacteria | 14058 |
| 169 | Ga0466718_083335 | 3300042617 | Unclassified | 2253 |
| 170 | Ga0466723_114374 | 3300042618 | Bacteria | 17921 |
| 171 | Ga0466726_172656 | 3300042619 | Bacteria | 2763 |
| 172 | Ga0466726_420530 | 3300042619 | Unclassified | 1237 |
| 173 | Ga0466707_060120 | 3300042601 | Bacteria | 2265 |
| 174 | Ga0466707_067863 | 3300042601 | Bacteria | 11167 |
| 175 | Ga0466720_036827 | 3300042607 | Bacteria | 40262 |
| 176 | Ga0466720_051715 | 3300042607 | Bacteria | 15672 |
| 177 | Ga0466698_488468 | 3300042610 | Bacteria | 10780 |
| 178 | AustNasuHG_c1025072 | 3300000089 | Unclassified | 1879 |
| 179 | JGI24698J34947_10000533 | 3300002449 | Bacteria | 17963 |
| 180 | JGI24698J34947_10039498 | 3300002449 | Unclassified | 2442 |
| 181 | JGI24695J34938_10000122 | 3300002450 | Bacteria | 69892 |
| 182 | Ga0072941_1034143 | 3300005201 | Bacteria | 9043 |
| 183 | Ga0072941_1168475 | 3300005201 | Bacteria | 2415 |
| 184 | Ga0456237_0000455 | 3300041968 | Bacteria | 6188 |
| 185 | Ga0466694_094800 | 3300042594 | Bacteria | 1961 |
| 186 | Ga0466694_406118 | 3300042594 | Archaea | 2366 |
| 187 | Ga0466696_391336 | 3300042596 | Bacteria | 16280 |
| 188 | Ga0466735_154193 | 3300042624 | Unclassified | 1867 |
| 189 | Ga0466735_160876 | 3300042624 | Bacteria | 1238 |
| 190 | Ga0466735_232819 | 3300042624 | Bacteria | 8693 |
| 191 | Ga0466703_158216 | 3300042636 | Bacteria | 4064 |
| 192 | Ga0466709_103879 | 3300042648 | Bacteria | 25802 |
| 193 | Ga0466732_003845 | 3300042656 | Bacteria | 7024 |
| 194 | Ga0466732_161354 | 3300042656 | Bacteria | 7138 |
| 195 | Ga0123353_10488335 | 3300010167 | Bacteria | 1799 |
| 196 | Ga0466712_039347 | 3300042614 | Bacteria | 2402 |
| 197 | Ga0466711_053417 | 3300042615 | Bacteria | 6365 |
| 198 | Ga0466718_051412 | 3300042617 | Bacteria | 10135 |
| 199 | Ga0466718_135665 | 3300042617 | Bacteria | 1304 |
| 200 | Ga0466700_149841 | 3300042600 | Bacteria | 1392 |
| 201 | Ga0466707_227106 | 3300042601 | Bacteria | 6822 |
| 202 | Ga0466716_526289 | 3300042605 | Bacteria | 12332 |
| 203 | Ga0466722_056201 | 3300042609 | Bacteria | 21056 |
| 204 | Ga0466698_107487 | 3300042610 | Bacteria | 3187 |
| 205 | Ga0264413_102690 | 3300024493 | Bacteria | 13996 |
| 206 | Ga0264413_103554 | 3300024493 | Bacteria | 7214 |
| 207 | Ga0264413_104505 | 3300024493 | Bacteria | 25126 |
| 208 | Ga0466691_084797 | 3300042593 | Bacteria | 28408 |
| 209 | Ga0466695_323358 | 3300042595 | Bacteria | 2274 |
| 210 | Ga0466699_019663 | 3300042597 | Bacteria | 9677 |
| 211 | Ga0466735_082530 | 3300042624 | Bacteria | 24525 |
| 212 | Ga0466708_171131 | 3300042652 | Bacteria | 4669 |
| 213 | Ga0466727_261903 | 3300042655 | Unclassified | 1702 |
| 214 | Ga0466727_262988 | 3300042655 | Bacteria | 1420 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00534 | GO:0016757 | glycosyltransferase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.