Protein Family IF07606
Metagenome
Isolate
214
Members
40
Samples
208
Scaffolds
350.94
Avg Length
Representative Sequence
- ID
- 3300042616|Ga0466715_016802|Ga0466715_016802_7726_8886
- Length
- 374 aa
- Sequence
- MSNEEPAGSKQQNLLLVHCSLLSVRVYWRIKGDHKMKRISFIVPGLLLVLALFGGCNRQSRAGGKGELTLYTWAEMFPQEILDGFESDTGIAVNYVNFDTDETMLTKLQTAGGGDYDLVIADDYIIETAIAEGLVQKLDKTRLPNYGNINPLYQKPFYDPLDEYTVPYGAGVVTLVYDPGRVATQIRGYADLWAPSLRGNVGLLGNHRVINGMALKTLGQSYNTNDTAVIRQAGERLLDLAPNIRLIRDDAAVMYTSQATAAKLANPGLEVVFPAEGIGFGIMGGFIPSKAPNPDAAYAFLNYILDAERGAACFEYLGYYSTFSASDPYINDEYRSFLTLPEGFNVNMEMIQNISAEAEEEHERIWTAFREQAQ
Sample Types
Isolate
2.8%
Metagenome
97.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
35.9%
Termitidae
33.3%
Unclassified
17.9%
Rhinotermitidae
5.1%
Termopsidae
5.1%
Hodotermitidae
2.6%
Taxonomy
Archaea
0
Bacteria
208
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 3 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 4 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 8 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 15 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 16 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 17 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 18 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 19 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 20 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 21 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 22 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 36 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 37 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 38 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_165932 | 3300042612 | Bacteria | 8382 |
| 2 | Ga0466705_386688 | 3300042612 | Bacteria | 6227 |
| 3 | Ga0466715_082108 | 3300042616 | Bacteria | 23420 |
| 4 | Ga0466715_217895 | 3300042616 | Bacteria | 11848 |
| 5 | Ga0466723_047931 | 3300042618 | Bacteria | 55036 |
| 6 | Ga0466723_094323 | 3300042618 | Bacteria | 6293 |
| 7 | Ga0466723_309570 | 3300042618 | Bacteria | 3566 |
| 8 | Ga0466723_317689 | 3300042618 | Bacteria | 1489 |
| 9 | Ga0466726_009545 | 3300042619 | Bacteria | 5732 |
| 10 | Ga0466726_116683 | 3300042619 | Bacteria | 2071 |
| 11 | Ga0466726_317544 | 3300042619 | Bacteria | 6012 |
| 12 | Ga0466719_214943 | 3300042606 | Bacteria | 15359 |
| 13 | Ga0466722_037884 | 3300042609 | Bacteria | 25328 |
| 14 | Ga0123353_10551931 | 3300010167 | Bacteria | 1661 |
| 15 | Ga0123353_10804583 | 3300010167 | Bacteria | 1297 |
| 16 | JGI24698J34947_10056490 | 3300002449 | Unclassified | 1951 |
| 17 | Ga0466702_047564 | 3300042635 | Bacteria | 2905 |
| 18 | Ga0466703_147752 | 3300042636 | Bacteria | 42366 |
| 19 | Ga0466703_352023 | 3300042636 | Bacteria | 1487 |
| 20 | Ga0466704_299985 | 3300042643 | Unclassified | 2404 |
| 21 | Ga0466708_034639 | 3300042652 | Bacteria | 2667 |
| 22 | Ga0466691_022259 | 3300042593 | Bacteria | 2362 |
| 23 | Ga0466691_070244 | 3300042593 | Bacteria | 2287 |
| 24 | Ga0466691_135053 | 3300042593 | Bacteria | 5475 |
| 25 | Ga0466694_180310 | 3300042594 | Bacteria | 3176 |
| 26 | Ga0466696_502085 | 3300042596 | Bacteria | 16388 |
| 27 | Ga0466705_141009 | 3300042612 | Bacteria | 7225 |
| 28 | Ga0466705_163865 | 3300042612 | Bacteria | 9108 |
| 29 | Ga0466711_273907 | 3300042615 | Bacteria | 17159 |
| 30 | Ga0466715_228808 | 3300042616 | Bacteria | 15887 |
| 31 | Ga0466715_263577 | 3300042616 | Bacteria | 9908 |
| 32 | Ga0466715_607180 | 3300042616 | Bacteria | 1562 |
| 33 | Ga0466715_609346 | 3300042616 | Bacteria | 16085 |
| 34 | Ga0466707_049873 | 3300042601 | Bacteria | 6934 |
| 35 | Ga0466707_068639 | 3300042601 | Bacteria | 42326 |
| 36 | Ga0466719_054689 | 3300042606 | Bacteria | 1941 |
| 37 | Ga0123353_10105622 | 3300010167 | Bacteria | 4538 |
| 38 | Ga0123353_10318590 | 3300010167 | Bacteria | 2361 |
| 39 | Ga0123354_10134659 | 3300010882 | Bacteria | 3098 |
| 40 | Ga0466703_054627 | 3300042636 | Bacteria | 12869 |
| 41 | Ga0466703_418518 | 3300042636 | Bacteria | 3884 |
| 42 | Ga0466704_521068 | 3300042643 | Bacteria | 15173 |
| 43 | Ga0466704_587173 | 3300042643 | Unclassified | 1264 |
| 44 | Ga0466709_120262 | 3300042648 | Bacteria | 1598 |
| 45 | Ga0466709_315522 | 3300042648 | Bacteria | 7040 |
| 46 | Ga0466708_034667 | 3300042652 | Bacteria | 2213 |
| 47 | Ga0466708_409942 | 3300042652 | Bacteria | 8109 |
| 48 | Ga0466691_133427 | 3300042593 | Bacteria | 8006 |
| 49 | Ga0466691_219051 | 3300042593 | Bacteria | 16741 |
| 50 | Ga0466705_069893 | 3300042612 | Bacteria | 4516 |
| 51 | Ga0466705_306938 | 3300042612 | Bacteria | 7133 |
| 52 | Ga0466715_317543 | 3300042616 | Bacteria | 15674 |
| 53 | Ga0466723_063655 | 3300042618 | Bacteria | 5949 |
| 54 | Ga0466723_317179 | 3300042618 | Bacteria | 4195 |
| 55 | Ga0466728_110305 | 3300042620 | Bacteria | 2649 |
| 56 | Ga0466728_139107 | 3300042620 | Bacteria | 2239 |
| 57 | Ga0466722_015484 | 3300042609 | Bacteria | 8934 |
| 58 | Ga0466722_131859 | 3300042609 | Bacteria | 2203 |
| 59 | Ga0123357_10002380 | 3300009784 | Bacteria | 20942 |
| 60 | Ga0466703_079535 | 3300042636 | Bacteria | 6130 |
| 61 | Ga0466703_188900 | 3300042636 | Bacteria | 6042 |
| 62 | Ga0466704_167337 | 3300042643 | Bacteria | 117281 |
| 63 | Ga0466704_547320 | 3300042643 | Bacteria | 5106 |
| 64 | Ga0466709_128487 | 3300042648 | Bacteria | 2993 |
| 65 | Ga0466708_060659 | 3300042652 | Bacteria | 41764 |
| 66 | Ga0466690_224629 | 3300042590 | Bacteria | 1858 |
| 67 | Ga0466690_328086 | 3300042590 | Bacteria | 4798 |
| 68 | Ga0466696_179720 | 3300042596 | Bacteria | 12517 |
| 69 | Ga0466705_097990 | 3300042612 | Bacteria | 4375 |
| 70 | Ga0466705_453126 | 3300042612 | Bacteria | 11428 |
| 71 | Ga0466711_253936 | 3300042615 | Bacteria | 4139 |
| 72 | Ga0466715_111095 | 3300042616 | Bacteria | 92411 |
| 73 | Ga0466715_202298 | 3300042616 | Bacteria | 4778 |
| 74 | Ga0466723_026305 | 3300042618 | Bacteria | 6123 |
| 75 | Ga0466728_208186 | 3300042620 | Bacteria | 8696 |
| 76 | Ga0466728_282607 | 3300042620 | Bacteria | 5154 |
| 77 | Ga0466700_040160 | 3300042600 | Bacteria | 10966 |
| 78 | Ga0466707_175531 | 3300042601 | Bacteria | 1228 |
| 79 | Ga0466716_381237 | 3300042605 | Bacteria | 4818 |
| 80 | Ga0466722_208453 | 3300042609 | Bacteria | 4466 |
| 81 | Ga0466722_227900 | 3300042609 | Bacteria | 19710 |
| 82 | Ga0466722_253203 | 3300042609 | Bacteria | 2746 |
| 83 | Ga0466698_210385 | 3300042610 | Bacteria | 1415 |
| 84 | Ga0123356_10075267 | 3300010049 | Bacteria | 3180 |
| 85 | Ga0123354_10268658 | 3300010882 | Bacteria | 1684 |
| 86 | JGI24702J35022_10001293 | 3300002462 | Bacteria | 15581 |
| 87 | JGI24702J35022_10004499 | 3300002462 | Bacteria | 8275 |
| 88 | Ga0466703_378392 | 3300042636 | Bacteria | 8053 |
| 89 | Ga0466704_022917 | 3300042643 | Bacteria | 5399 |
| 90 | Ga0466704_079792 | 3300042643 | Bacteria | 1403 |
| 91 | Ga0466704_093652 | 3300042643 | Bacteria | 5238 |
| 92 | Ga0466704_144769 | 3300042643 | Bacteria | 13285 |
| 93 | Ga0466704_236045 | 3300042643 | Bacteria | 8542 |
| 94 | Ga0466708_038995 | 3300042652 | Bacteria | 14766 |
| 95 | Ga0466708_094535 | 3300042652 | Bacteria | 2161 |
| 96 | Ga0466708_202930 | 3300042652 | Bacteria | 11826 |
| 97 | Ga0466727_067374 | 3300042655 | Bacteria | 2879 |
| 98 | Ga0466690_280047 | 3300042590 | Bacteria | 2029 |
| 99 | Ga0466691_077808 | 3300042593 | Bacteria | 2909 |
| 100 | Ga0466691_170180 | 3300042593 | Bacteria | 4791 |
| 101 | Ga0466699_047383 | 3300042597 | Bacteria | 16831 |
| 102 | Ga0466705_332532 | 3300042612 | Bacteria | 16839 |
| 103 | Ga0466705_447586 | 3300042612 | Bacteria | 1325 |
| 104 | Ga0466712_001266 | 3300042614 | Bacteria | 4216 |
| 105 | Ga0466711_251758 | 3300042615 | Bacteria | 4701 |
| 106 | Ga0466715_016802 | 3300042616 | Bacteria | 9613 |
| 107 | Ga0466718_033123 | 3300042617 | Bacteria | 32896 |
| 108 | Ga0466723_193082 | 3300042618 | Bacteria | 7715 |
| 109 | Ga0466726_071276 | 3300042619 | Bacteria | 9224 |
| 110 | Ga0466728_239936 | 3300042620 | Bacteria | 8878 |
| 111 | Ga0466722_055850 | 3300042609 | Bacteria | 4802 |
| 112 | Ga0072941_1059209 | 3300005201 | Bacteria | 6279 |
| 113 | Ga0466704_021819 | 3300042643 | Bacteria | 31352 |
| 114 | Ga0466709_046874 | 3300042648 | Bacteria | 14776 |
| 115 | Ga0466709_145285 | 3300042648 | Bacteria | 13604 |
| 116 | Ga0466709_209616 | 3300042648 | Bacteria | 2164 |
| 117 | Ga0466708_136585 | 3300042652 | Bacteria | 9440 |
| 118 | Ga0466691_027063 | 3300042593 | Bacteria | 4788 |
| 119 | Ga0466694_090753 | 3300042594 | Bacteria | 1484 |
| 120 | Ga0466696_300163 | 3300042596 | Bacteria | 19461 |
| 121 | Ga0466696_408877 | 3300042596 | Bacteria | 3780 |
| 122 | Ga0466699_073455 | 3300042597 | Bacteria | 8832 |
| 123 | Ga0466699_349591 | 3300042597 | Bacteria | 8909 |
| 124 | Ga0466699_423391 | 3300042597 | Bacteria | 1154 |
| 125 | Ga0466705_117515 | 3300042612 | Bacteria | 18432 |
| 126 | Ga0466705_361677 | 3300042612 | Bacteria | 2477 |
| 127 | Ga0466705_412262 | 3300042612 | Bacteria | 8763 |
| 128 | Ga0466723_296256 | 3300042618 | Bacteria | 1693 |
| 129 | Ga0466726_394109 | 3300042619 | Bacteria | 2954 |
| 130 | Ga0466728_151580 | 3300042620 | Bacteria | 15860 |
| 131 | Ga0466728_223594 | 3300042620 | Bacteria | 4512 |
| 132 | Ga0466719_189128 | 3300042606 | Bacteria | 5568 |
| 133 | Ga0466719_310245 | 3300042606 | Bacteria | 9151 |
| 134 | Ga0466722_212889 | 3300042609 | Bacteria | 4815 |
| 135 | Ga0123356_10157408 | 3300010049 | Bacteria | 2264 |
| 136 | Ga0123353_10324781 | 3300010167 | Bacteria | 2333 |
| 137 | Ga0466703_189388 | 3300042636 | Bacteria | 18352 |
| 138 | Ga0466704_499287 | 3300042643 | Bacteria | 13174 |
| 139 | Ga0466704_570844 | 3300042643 | Bacteria | 20730 |
| 140 | Ga0466704_585141 | 3300042643 | Bacteria | 4455 |
| 141 | Ga0466709_224487 | 3300042648 | Bacteria | 13774 |
| 142 | Ga0466709_313306 | 3300042648 | Bacteria | 2926 |
| 143 | Ga0466727_076781 | 3300042655 | Bacteria | 1925 |
| 144 | Ga0466690_329965 | 3300042590 | Unclassified | 12055 |
| 145 | Ga0466691_209990 | 3300042593 | Bacteria | 3409 |
| 146 | Ga0466694_301467 | 3300042594 | Bacteria | 75509 |
| 147 | Ga0466694_308955 | 3300042594 | Bacteria | 7398 |
| 148 | Ga0466696_136356 | 3300042596 | Bacteria | 19161 |
| 149 | Ga0466699_093114 | 3300042597 | Bacteria | 9217 |
| 150 | Ga0466699_209505 | 3300042597 | Bacteria | 21459 |
| 151 | Ga0466705_132143 | 3300042612 | Bacteria | 10209 |
| 152 | Ga0466712_283892 | 3300042614 | Bacteria | 7071 |
| 153 | Ga0466711_191871 | 3300042615 | Bacteria | 10434 |
| 154 | Ga0466711_209538 | 3300042615 | Bacteria | 10885 |
| 155 | Ga0466715_238104 | 3300042616 | Bacteria | 5282 |
| 156 | Ga0466723_151535 | 3300042618 | Bacteria | 1669 |
| 157 | Ga0466726_382937 | 3300042619 | Bacteria | 1259 |
| 158 | Ga0466728_069527 | 3300042620 | Bacteria | 2453 |
| 159 | Ga0466706_151292 | 3300042599 | Bacteria | 4288 |
| 160 | Ga0466722_092757 | 3300042609 | Unclassified | 3905 |
| 161 | Ga0123353_10492489 | 3300010167 | Bacteria | 1789 |
| 162 | JGI24702J35022_10025105 | 3300002462 | Bacteria | 3218 |
| 163 | JGI24702J35022_10089908 | 3300002462 | Bacteria | 1670 |
| 164 | Ga0072941_1082207 | 3300005201 | Bacteria | 2529 |
| 165 | Ga0466704_020506 | 3300042643 | Bacteria | 4223 |
| 166 | Ga0466704_449792 | 3300042643 | Bacteria | 11966 |
| 167 | Ga0466709_336548 | 3300042648 | Bacteria | 5140 |
| 168 | Ga0466708_346310 | 3300042652 | Bacteria | 15336 |
| 169 | Ga0466690_008560 | 3300042590 | Unclassified | 1692 |
| 170 | Ga0466690_340571 | 3300042590 | Bacteria | 2759 |
| 171 | Ga0466690_348061 | 3300042590 | Bacteria | 2968 |
| 172 | Ga0466692_184056 | 3300042591 | Bacteria | 19674 |
| 173 | Ga0466691_043113 | 3300042593 | Bacteria | 3496 |
| 174 | Ga0466694_031300 | 3300042594 | Bacteria | 1584 |
| 175 | Ga0466694_071888 | 3300042594 | Bacteria | 1904 |
| 176 | Ga0466696_322632 | 3300042596 | Bacteria | 5248 |
| 177 | Ga0466696_367318 | 3300042596 | Bacteria | 4158 |
| 178 | Ga0466696_448334 | 3300042596 | Bacteria | 2688 |
| 179 | Ga0466705_083175 | 3300042612 | Bacteria | 3237 |
| 180 | Ga0466705_370117 | 3300042612 | Bacteria | 4063 |
| 181 | Ga0466711_169095 | 3300042615 | Bacteria | 18446 |
| 182 | Ga0466715_427264 | 3300042616 | Bacteria | 4577 |
| 183 | Ga0466723_001565 | 3300042618 | Bacteria | 19551 |
| 184 | Ga0466723_050339 | 3300042618 | Bacteria | 3446 |
| 185 | Ga0466723_080724 | 3300042618 | Bacteria | 19184 |
| 186 | Ga0466728_025221 | 3300042620 | Bacteria | 4815 |
| 187 | Ga0466728_099734 | 3300042620 | Bacteria | 18107 |
| 188 | Ga0466700_194204 | 3300042600 | Bacteria | 1073 |
| 189 | Ga0466716_148934 | 3300042605 | Bacteria | 5060 |
| 190 | Ga0466719_052953 | 3300042606 | Bacteria | 4166 |
| 191 | Ga0466719_128508 | 3300042606 | Bacteria | 10371 |
| 192 | Ga0466719_564238 | 3300042606 | Bacteria | 7684 |
| 193 | Ga0466722_175616 | 3300042609 | Bacteria | 2259 |
| 194 | Ga0123357_10071315 | 3300009784 | Bacteria | 4607 |
| 195 | Ga0123353_10120405 | 3300010167 | Bacteria | 4221 |
| 196 | Ga0072941_1034814 | 3300005201 | Bacteria | 3645 |
| 197 | Ga0072941_1082190 | 3300005201 | Bacteria | 3003 |
| 198 | Ga0466703_036267 | 3300042636 | Bacteria | 7357 |
| 199 | Ga0466703_186550 | 3300042636 | Bacteria | 31727 |
| 200 | Ga0466709_187137 | 3300042648 | Bacteria | 4148 |
| 201 | Ga0466709_378607 | 3300042648 | Bacteria | 7895 |
| 202 | Ga0466708_104645 | 3300042652 | Bacteria | 9725 |
| 203 | Ga0466692_106428 | 3300042591 | Bacteria | 7688 |
| 204 | Ga0466691_226438 | 3300042593 | Bacteria | 2672 |
| 205 | Ga0466694_016449 | 3300042594 | Bacteria | 1898 |
| 206 | Ga0466696_113952 | 3300042596 | Bacteria | 2790 |
| 207 | Ga0466696_212353 | 3300042596 | Bacteria | 3675 |
| 208 | Ga0466699_208246 | 3300042597 | Bacteria | 1974 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01547 | SBP_bac_1 | Bacterial extracellular solute-binding protein | 250 | 308 | 0.95 |
| PF13343 | SBP_bac_6 | Bacterial extracellular solute-binding protein | 117 | 318 | 0.85 |
| PF13416 | SBP_bac_8 | Bacterial extracellular solute-binding protein | 81 | 326 | 0.83 |
| PF13531 | SBP_bac_11 | Bacterial extracellular solute-binding protein | 79 | 308 | 0.79 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.