Protein Family IF07557

Metagenome Isolate
159 Members
48 Samples
145 Scaffolds
222.9 Avg Length

🧬 Representative Sequence

ID
3300042615|Ga0466711_373680|Ga0466711_373680_5364_6068
Length
234 aa
Sequence
MIEYVVPANIDDRILARGAALLGEGGLLALPTDTSWSIVCSLRGREGIKKLRRLSGERDERHFTLLCGDISQFGEFCGMDNTRFRIIKRLSPGPYVFILRTLSGTDKALGLRRRELGVRIPNHPVPLGLIKTLNQPLYSVTAKRGMTAAGEAAGYADNPPDPKPSGPEKAAADTELPPIPEEQLFEGGWELEAVPELAMILDPGEDQKRIFSTILDMTGDEVLQIRRGAGPWPV

📊 Sample Types

Isolate 8.8%
Metagenome 91.2%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 45.7%
Unclassified 30.4%
Kalotermitidae 15.2%
Rhinotermitidae 4.3%
Termopsidae 4.3%

🌳 Taxonomy

Archaea 1
Bacteria 148
Eukaryota 0
Viruses 0
Unclassified 10

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
2 2781125661 Treponema sp. Emb289P3bin69 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
5 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
6 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
7 2781125660 Treponema sp. Emb289P3bin52 Isolate Unclassified
8 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
9 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
10 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
11 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
12 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
13 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
14 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
15 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
16 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
17 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
18 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
19 2781125664 Treponema sp. Emb289P3bin139 Isolate Unclassified
20 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
21 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
22 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
23 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
24 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
25 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
26 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
27 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
30 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
31 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
32 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
33 2781125659 Treponema sp. Emb289P3bin114 Isolate Unclassified
34 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
35 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
36 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
37 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
38 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
39 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
40 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
41 2781125663 Treponema sp. Emb289P3bin135 Isolate Unclassified
42 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
43 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
44 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
45 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
46 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
47 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
48 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0264413_100122 3300024493 Bacteria 35376
2 Ga0264413_105441 3300024493 Bacteria 14152
3 Ga0466693_102995 3300042592 Bacteria 28234
4 Ga0466700_193849 3300042600 Bacteria 35866
5 Ga0466720_034631 3300042607 Bacteria 3059
6 Ga0466721_369925 3300042608 Bacteria 1932
7 Ga0123356_10012027 3300010049 Bacteria 8418
8 Ga0123356_10150550 3300010049 Bacteria 2309
9 JGI24698J34947_10024000 3300002449 Bacteria 3259
10 JGI24695J34938_10000096 3300002450 Bacteria 77675
11 JGI24695J34938_10004451 3300002450 Bacteria 9175
12 JGI24695J34938_10009940 3300002450 Bacteria 5250
13 Ga0072941_1071392 3300005201 Bacteria 1039
14 Ga0466712_076865 3300042614 Bacteria 13555
15 Ga0466712_219998 3300042614 Bacteria 5737
16 Ga0466712_228187 3300042614 Bacteria 1609
17 Ga0466718_106723 3300042617 Bacteria 4118
18 Ga0466709_070156 3300042648 Bacteria 1739
19 Ga0415639_003874 3300038395 Bacteria 8355
20 Ga0466694_040501 3300042594 Bacteria 1422
21 Ga0466694_073365 3300042594 Bacteria 9711
22 Ga0466721_225174 3300042608 Bacteria 32299
23 Ga0123356_10000396 3300010049 Bacteria 49792
24 Ga0123356_10004959 3300010049 Unclassified 13646
25 AustNasuHG_c1011670 3300000089 Bacteria 3043
26 AustNasuHG_c1019930 3300000089 Bacteria 2192
27 JGI24698J34947_10001627 3300002449 Bacteria 11962
28 JGI24698J34947_10005206 3300002449 Bacteria 7134
29 JGI24698J34947_10024351 3300002449 Bacteria 3232
30 JGI24695J34938_10000391 3300002450 Bacteria 43169
31 JGI24695J34938_10001755 3300002450 Bacteria 17905
32 JGI24695J34938_10001812 3300002450 Bacteria 17459
33 JGI24695J34938_10003857 3300002450 Bacteria 10162
34 Ga0466718_034878 3300042617 Bacteria 14386
35 Ga0466727_110311 3300042655 Bacteria 16660
36 Ga0264413_118125 3300024493 Unclassified 3673
37 Ga0264413_129216 3300024493 Unclassified 7660
38 Ga0466699_211304 3300042597 Bacteria 1022
39 Ga0466698_185492 3300042610 Bacteria 1088
40 Ga0123356_10000104 3300010049 Bacteria 89487
41 Ga0123356_10000123 3300010049 Bacteria 85175
42 Ga0123356_10005308 3300010049 Bacteria 13139
43 Ga0123356_10025738 3300010049 Bacteria 5531
44 Ga0123356_10161270 3300010049 Bacteria 2240
45 Ga0123356_10224379 3300010049 Bacteria 1938
46 Ga0123356_10685103 3300010049 Archaea 1193
47 Ga0123353_10362709 3300010167 Bacteria 2176
48 AustNasuHG_c1002442 3300000089 Bacteria 6719
49 JGI24698J34947_10059477 3300002449 Unclassified 1889
50 JGI24698J34947_10065662 3300002449 Bacteria 1768
51 JGI24698J34947_10157404 3300002449 Unclassified 935
52 JGI24695J34938_10002046 3300002450 Bacteria 15924
53 JGI24695J34938_10019745 3300002450 Bacteria 3330
54 Ga0072941_1026555 3300005201 Bacteria 16285
55 Ga0466712_049444 3300042614 Bacteria 2128
56 Ga0466712_125386 3300042614 Bacteria 1109
57 Ga0466726_146276 3300042619 Bacteria 8869
58 Ga0466727_333089 3300042655 Bacteria 1644
59 Ga0415639_089692 3300038395 Bacteria 2602
60 Ga0466694_107500 3300042594 Bacteria 2213
61 Ga0466694_239789 3300042594 Bacteria 30860
62 Ga0466720_030290 3300042607 Unclassified 12839
63 Ga0466721_333389 3300042608 Bacteria 1450
64 Ga0123356_11349912 3300010049 Bacteria 875
65 JGI24698J34947_10031993 3300002449 Bacteria 2765
66 JGI24695J34938_10000951 3300002450 Bacteria 26419
67 JGI24695J34938_10006697 3300002450 Bacteria 6862
68 JGI24695J34938_10008304 3300002450 Bacteria 5937
69 Ga0466712_144617 3300042614 Unclassified 2498
70 Ga0466723_264736 3300042618 Bacteria 1414
71 Ga0466708_161439 3300042652 Bacteria 7835
72 Ga0264413_118894 3300024493 Bacteria 3988
73 Ga0466692_124833 3300042591 Bacteria 6424
74 Ga0466694_201409 3300042594 Bacteria 6401
75 Ga0466699_076368 3300042597 Bacteria 8107
76 Ga0466720_023907 3300042607 Bacteria 7778
77 Ga0466722_181132 3300042609 Bacteria 5101
78 Ga0123356_10003673 3300010049 Bacteria 15994
79 Ga0123356_10012461 3300010049 Bacteria 8247
80 Ga0123356_10293780 3300010049 Bacteria 1727
81 Ga0123356_11200060 3300010049 Bacteria 925
82 AustNasuHG_c1018157 3300000089 Bacteria 2326
83 JGI24698J34947_10009109 3300002449 Bacteria 5446
84 JGI24698J34947_10017353 3300002449 Bacteria 3900
85 JGI24695J34938_10000346 3300002450 Bacteria 45617
86 JGI24695J34938_10000802 3300002450 Bacteria 29173
87 JGI24700J35501_10916384 3300002508 Bacteria 4035
88 Ga0072940_1054331 3300005200 Unclassified 1684
89 Ga0072940_1067803 3300005200 Bacteria 2463
90 Ga0074263_117362 3300005485 Bacteria 2294
91 Ga0466712_080014 3300042614 Bacteria 3143
92 Ga0466712_261014 3300042614 Bacteria 2503
93 Ga0466712_303422 3300042614 Bacteria 26264
94 Ga0466718_023654 3300042617 Bacteria 14017
95 Ga0466718_109066 3300042617 Bacteria 12546
96 Ga0466718_124210 3300042617 Bacteria 3029
97 Ga0466720_117061 3300042607 Bacteria 5738
98 Ga0466720_143365 3300042607 Bacteria 4872
99 Ga0466721_349298 3300042608 Bacteria 7073
100 Ga0123356_10012132 3300010049 Bacteria 8376
101 Ga0123356_10084825 3300010049 Bacteria 3003
102 Ga0123356_10727572 3300010049 Unclassified 1162
103 JGI24698J34947_10092737 3300002449 Bacteria 1380
104 Ga0072941_1001786 3300005201 Bacteria 12629
105 Ga0466731_284762 3300042622 Bacteria 1206
106 Ga0466705_093372 3300042612 Bacteria 1999
107 Ga0466732_215056 3300042656 Bacteria 5043
108 Ga0466692_001629 3300042591 Bacteria 6740
109 Ga0466692_014973 3300042591 Bacteria 10349
110 Ga0466695_025282 3300042595 Bacteria 46128
111 Ga0466720_158413 3300042607 Bacteria 12941
112 Ga0466720_181002 3300042607 Bacteria 45355
113 AustNasuHG_c1001969 3300000089 Bacteria 7379
114 JGI24698J34947_10006657 3300002449 Bacteria 6345
115 JGI24695J34938_10000164 3300002450 Bacteria 61824
116 JGI24695J34938_10001465 3300002450 Bacteria 19962
117 JGI24695J34938_10001566 3300002450 Bacteria 19253
118 JGI24695J34938_10003131 3300002450 Bacteria 11784
119 JGI24695J34938_10017078 3300002450 Bacteria 3669
120 Ga0466712_003935 3300042614 Bacteria 1556
121 Ga0466712_121046 3300042614 Bacteria 6180
122 Ga0466718_145046 3300042617 Bacteria 4489
123 Ga0466723_264635 3300042618 Bacteria 13376
124 Ga0466731_151566 3300042622 Bacteria 1934
125 Ga0466709_294059 3300042648 Bacteria 3838
126 Ga0415639_056454 3300038395 Bacteria 10563
127 Ga0466691_094312 3300042593 Bacteria 3932
128 Ga0466694_050440 3300042594 Bacteria 148325
129 Ga0466699_104622 3300042597 Bacteria 6692
130 Ga0466720_100057 3300042607 Bacteria 3803
131 Ga0123356_10074078 3300010049 Bacteria 3203
132 AustNasuHG_c1031174 3300000089 Bacteria 1514
133 JGI24698J34947_10009605 3300002449 Bacteria 5301
134 JGI24698J34947_10011406 3300002449 Bacteria 4880
135 JGI24698J34947_10014837 3300002449 Unclassified 4243
136 JGI24698J34947_10016860 3300002449 Bacteria 3963
137 JGI24698J34947_10067453 3300002449 Bacteria 1736
138 JGI24695J34938_10025950 3300002450 Bacteria 2792
139 Ga0072941_1099092 3300005201 Bacteria 1771
140 Ga0466712_022483 3300042614 Bacteria 12558
141 Ga0466712_168014 3300042614 Bacteria 14787
142 Ga0466711_373680 3300042615 Bacteria 13113
143 Ga0466715_279278 3300042616 Bacteria 20882
144 Ga0466718_071356 3300042617 Bacteria 1627
145 Ga0466731_142248 3300042622 Bacteria 6311

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF01300 Sua5_yciO_yrdC Telomere recombination 21 143 0.94

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF01300 GO:0003725 double-stranded RNA binding MF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.