Protein Family IF07490
Metagenome
Isolate
125
Members
31
Samples
124
Scaffolds
159.86
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_118849|Ga0466711_118849_5887_6423
- Length
- 178 aa
- Sequence
- MNGNFWKNYPESRYKFKDSTMEQYIQPFIDVCKNVFKEFIGAELTVGRPYFSSRETVDEWDISAVIGLTGEARGAVVISMKKDLALKLTDILAGGGHQDADEEVVDAIGEIINIIAGNAKQGLEAAFKLVISLPTIVQGKEHLIKWPNAQTRIICIPFTIFGNHVFNLSVAIQSVRGA
Sample Types
Isolate
0.8%
Metagenome
99.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
26.7%
Rhinotermitidae
10.0%
Termopsidae
10.0%
Unclassified
3.3%
Blaberidae
3.3%
Taxonomy
Archaea
0
Bacteria
112
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 5 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 8 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 9 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 10 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 11 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 12 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 13 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 14 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 15 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 16 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 17 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 18 | 3300042550 | Termite gut microbial communities of Alyscotermes sp. from Kakamega Forest Station, Kenya - Aly426 | Metagenome | Termitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 22 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 25 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 26 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 27 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 28 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 29 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 30 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 31 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_068047 | 3300042612 | Bacteria | 14016 |
| 2 | Ga0466711_011556 | 3300042615 | Bacteria | 5493 |
| 3 | Ga0466711_029362 | 3300042615 | Bacteria | 4754 |
| 4 | Ga0466728_119528 | 3300042620 | Bacteria | 22681 |
| 5 | Ga0466728_217286 | 3300042620 | Bacteria | 3743 |
| 6 | Ga0123357_10016352 | 3300009784 | Bacteria | 9761 |
| 7 | Ga0123353_10007636 | 3300010167 | Bacteria | 14654 |
| 8 | Ga0466719_118850 | 3300042606 | Bacteria | 22662 |
| 9 | Ga0466722_006906 | 3300042609 | Bacteria | 2483 |
| 10 | Ga0466722_155562 | 3300042609 | Bacteria | 5009 |
| 11 | Ga0466722_199806 | 3300042609 | Bacteria | 3568 |
| 12 | Ga0466690_306705 | 3300042590 | Unclassified | 5446 |
| 13 | Ga0466696_066416 | 3300042596 | Bacteria | 11514 |
| 14 | Ga0466735_041731 | 3300042624 | Bacteria | 1149 |
| 15 | Ga0466703_013993 | 3300042636 | Bacteria | 19436 |
| 16 | Ga0466703_306142 | 3300042636 | Bacteria | 6822 |
| 17 | Ga0466708_285068 | 3300042652 | Unclassified | 1487 |
| 18 | Ga0466727_192667 | 3300042655 | Bacteria | 2997 |
| 19 | Ga0466705_315960 | 3300042612 | Bacteria | 5870 |
| 20 | Ga0466711_180722 | 3300042615 | Bacteria | 11397 |
| 21 | Ga0466711_476591 | 3300042615 | Bacteria | 12735 |
| 22 | Ga0466715_565191 | 3300042616 | Bacteria | 9958 |
| 23 | Ga0466707_348474 | 3300042601 | Bacteria | 2834 |
| 24 | Ga0466722_092736 | 3300042609 | Bacteria | 2954 |
| 25 | Ga0466703_210110 | 3300042636 | Bacteria | 87073 |
| 26 | Ga0466704_202407 | 3300042643 | Bacteria | 10285 |
| 27 | Ga0466709_238050 | 3300042648 | Bacteria | 17478 |
| 28 | Ga0466709_291870 | 3300042648 | Bacteria | 15952 |
| 29 | Ga0466708_081361 | 3300042652 | Bacteria | 4282 |
| 30 | Ga0466727_138677 | 3300042655 | Bacteria | 2621 |
| 31 | Ga0466705_157964 | 3300042612 | Bacteria | 4846 |
| 32 | Ga0466711_114144 | 3300042615 | Bacteria | 4353 |
| 33 | Ga0466723_079443 | 3300042618 | Bacteria | 2053 |
| 34 | Ga0466723_116550 | 3300042618 | Bacteria | 1599 |
| 35 | Ga0466726_130749 | 3300042619 | Bacteria | 7613 |
| 36 | Ga0466728_401783 | 3300042620 | Bacteria | 5079 |
| 37 | Ga0466716_403111 | 3300042605 | Bacteria | 4960 |
| 38 | Ga0466708_009081 | 3300042652 | Bacteria | 16963 |
| 39 | Ga0466708_171234 | 3300042652 | Bacteria | 2847 |
| 40 | Ga0466705_440001 | 3300042612 | Bacteria | 2429 |
| 41 | Ga0466711_022411 | 3300042615 | Bacteria | 3339 |
| 42 | Ga0466711_426874 | 3300042615 | Bacteria | 8760 |
| 43 | Ga0466711_446733 | 3300042615 | Bacteria | 1704 |
| 44 | Ga0466715_147164 | 3300042616 | Bacteria | 17560 |
| 45 | Ga0466715_359951 | 3300042616 | Bacteria | 1613 |
| 46 | Ga0466723_089347 | 3300042618 | Unclassified | 2598 |
| 47 | Ga0466726_307780 | 3300042619 | Bacteria | 1264 |
| 48 | Ga0466729_149991 | 3300042621 | Unclassified | 1617 |
| 49 | Ga0466716_312165 | 3300042605 | Bacteria | 10896 |
| 50 | Ga0466719_436180 | 3300042606 | Bacteria | 1932 |
| 51 | Ga0466690_401342 | 3300042590 | Bacteria | 4817 |
| 52 | Ga0466735_203493 | 3300042624 | Bacteria | 1460 |
| 53 | Ga0466704_428099 | 3300042643 | Bacteria | 18779 |
| 54 | JGI24705J35276_12187374 | 3300002504 | Bacteria | 1429 |
| 55 | Ga0466711_441473 | 3300042615 | Bacteria | 41991 |
| 56 | Ga0466715_093829 | 3300042616 | Bacteria | 26315 |
| 57 | Ga0466726_036523 | 3300042619 | Bacteria | 3159 |
| 58 | Ga0123356_13671700 | 3300010049 | Bacteria | 531 |
| 59 | Ga0466696_465792 | 3300042596 | Bacteria | 1913 |
| 60 | Ga0466735_128786 | 3300042624 | Bacteria | 3084 |
| 61 | Ga0466709_142334 | 3300042648 | Bacteria | 9021 |
| 62 | Ga0466708_221151 | 3300042652 | Bacteria | 4775 |
| 63 | Ga0466727_333764 | 3300042655 | Bacteria | 1684 |
| 64 | JGI24705J35276_12233291 | 3300002504 | Bacteria | 4760 |
| 65 | Ga0466705_157947 | 3300042612 | Bacteria | 11546 |
| 66 | Ga0466733_112084 | 3300042659 | Bacteria | 4043 |
| 67 | Ga0466711_118849 | 3300042615 | Bacteria | 10253 |
| 68 | Ga0466715_110855 | 3300042616 | Unclassified | 4428 |
| 69 | Ga0466715_351505 | 3300042616 | Unclassified | 8356 |
| 70 | Ga0466715_359064 | 3300042616 | Bacteria | 2884 |
| 71 | Ga0466723_224336 | 3300042618 | Bacteria | 2268 |
| 72 | Ga0466728_302063 | 3300042620 | Bacteria | 6252 |
| 73 | Ga0466719_100250 | 3300042606 | Bacteria | 17752 |
| 74 | Ga0466722_049511 | 3300042609 | Bacteria | 3777 |
| 75 | Ga0466722_235375 | 3300042609 | Bacteria | 3392 |
| 76 | Ga0466690_203975 | 3300042590 | Bacteria | 9971 |
| 77 | Ga0466696_016261 | 3300042596 | Bacteria | 10401 |
| 78 | Ga0466696_138427 | 3300042596 | Bacteria | 3297 |
| 79 | Ga0466703_090140 | 3300042636 | Bacteria | 2495 |
| 80 | Ga0466703_361847 | 3300042636 | Bacteria | 4373 |
| 81 | Ga0466703_392601 | 3300042636 | Bacteria | 4310 |
| 82 | Ga0466704_001289 | 3300042643 | Unclassified | 13319 |
| 83 | Ga0466704_546677 | 3300042643 | Unclassified | 1344 |
| 84 | Ga0466727_287400 | 3300042655 | Bacteria | 1398 |
| 85 | JGI24698J34947_10004671 | 3300002449 | Bacteria | 7473 |
| 86 | JGI24705J35276_11527571 | 3300002504 | Bacteria | 566 |
| 87 | Ga0072941_1027684 | 3300005201 | Unclassified | 2415 |
| 88 | Ga0466715_165388 | 3300042616 | Bacteria | 1747 |
| 89 | Ga0466726_447332 | 3300042619 | Unclassified | 1282 |
| 90 | Ga0466728_163781 | 3300042620 | Bacteria | 2254 |
| 91 | Ga0466716_082956 | 3300042605 | Bacteria | 2075 |
| 92 | Ga0466722_146738 | 3300042609 | Bacteria | 4336 |
| 93 | Ga0466722_156470 | 3300042609 | Bacteria | 3634 |
| 94 | Ga0466656_043817 | 3300042550 | Bacteria | 1028 |
| 95 | Ga0466692_010008 | 3300042591 | Bacteria | 14489 |
| 96 | Ga0466691_141615 | 3300042593 | Bacteria | 5860 |
| 97 | Ga0466696_012727 | 3300042596 | Bacteria | 6837 |
| 98 | Ga0466735_184223 | 3300042624 | Bacteria | 1022 |
| 99 | Ga0466704_024706 | 3300042643 | Bacteria | 5446 |
| 100 | Ga0466704_031286 | 3300042643 | Bacteria | 5706 |
| 101 | Ga0466704_121150 | 3300042643 | Bacteria | 3903 |
| 102 | Ga0466704_575874 | 3300042643 | Bacteria | 1697 |
| 103 | Ga0466708_035070 | 3300042652 | Bacteria | 8052 |
| 104 | Ga0466708_073487 | 3300042652 | Bacteria | 7381 |
| 105 | JGI24702J35022_10003430 | 3300002462 | Bacteria | 9554 |
| 106 | JGI24705J35276_12218254 | 3300002504 | Bacteria | 2135 |
| 107 | Ga0072941_1054453 | 3300005201 | Bacteria | 5374 |
| 108 | Ga0466705_280223 | 3300042612 | Unclassified | 4207 |
| 109 | Ga0466711_504216 | 3300042615 | Bacteria | 2500 |
| 110 | Ga0466715_368267 | 3300042616 | Bacteria | 4651 |
| 111 | Ga0466715_604338 | 3300042616 | Unclassified | 2407 |
| 112 | Ga0466723_024153 | 3300042618 | Bacteria | 15986 |
| 113 | Ga0466726_162387 | 3300042619 | Bacteria | 1636 |
| 114 | Ga0466728_022115 | 3300042620 | Bacteria | 13619 |
| 115 | Ga0466728_170239 | 3300042620 | Bacteria | 7365 |
| 116 | Ga0123356_10965589 | 3300010049 | Bacteria | 1023 |
| 117 | Ga0466722_062804 | 3300042609 | Unclassified | 1666 |
| 118 | Ga0466722_066249 | 3300042609 | Bacteria | 12867 |
| 119 | Ga0466690_168322 | 3300042590 | Bacteria | 1761 |
| 120 | Ga0466703_177369 | 3300042636 | Bacteria | 10116 |
| 121 | Ga0466704_449283 | 3300042643 | Bacteria | 2253 |
| 122 | Ga0466709_329577 | 3300042648 | Bacteria | 2698 |
| 123 | Ga0466727_064067 | 3300042655 | Bacteria | 6319 |
| 124 | Ga0466727_302520 | 3300042655 | Bacteria | 11253 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13690 | CheX | Chemotaxis phosphatase CheX | 62 | 158 | 0.9 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.