Protein Family IF07475
Metagenome
117
Members
35
Samples
117
Scaffolds
148.55
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_090342|Ga0466711_090342_2068_2541
- Length
- 157 aa
- Sequence
- MKVRTKETTHKIMSAIKNKDTSPELFFRKALWKWGVRYRKNVNLFGRPDIAIKKYKLVIFIDGDFWHGNNWRTRKFPSLEAELKKYSDFWKNKILKNIARDNKVNEYYRSKNWIILRFWQSDIEQDLNNCIIKTIDIINELKNNMRGVTPHTRSFIP
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
43.8%
Termitidae
40.6%
Rhinotermitidae
6.2%
Termopsidae
6.2%
Hodotermitidae
3.1%
Taxonomy
Archaea
1
Bacteria
99
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 3 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 4 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 5 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 6 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 9 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 10 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 11 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 12 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 13 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 14 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 15 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 16 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 19 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 20 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 21 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 22 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 23 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 24 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 25 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 26 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 27 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 28 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 29 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 30 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 34 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 35 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | JGI24698J34947_10004733 | 3300002449 | Bacteria | 7432 |
| 2 | JGI24698J34947_10037280 | 3300002449 | Bacteria | 2527 |
| 3 | Ga0466729_232123 | 3300042621 | Bacteria | 2091 |
| 4 | Ga0466731_295776 | 3300042622 | Bacteria | 1783 |
| 5 | Ga0466704_086073 | 3300042643 | Bacteria | 6809 |
| 6 | Ga0466708_253858 | 3300042652 | Bacteria | 1413 |
| 7 | Ga0264413_100658 | 3300024493 | Bacteria | 43357 |
| 8 | Ga0264413_129694 | 3300024493 | Bacteria | 4298 |
| 9 | Ga0264413_130900 | 3300024493 | Bacteria | 2855 |
| 10 | Ga0466694_278045 | 3300042594 | Bacteria | 1093 |
| 11 | Ga0466696_233394 | 3300042596 | Bacteria | 32889 |
| 12 | Ga0466706_097825 | 3300042599 | Bacteria | 1569 |
| 13 | Ga0466706_247546 | 3300042599 | Bacteria | 1239 |
| 14 | Ga0466700_234179 | 3300042600 | Bacteria | 1783 |
| 15 | Ga0466716_066511 | 3300042605 | Bacteria | 8952 |
| 16 | Ga0466716_140928 | 3300042605 | Unclassified | 2266 |
| 17 | Ga0466716_346379 | 3300042605 | Bacteria | 2942 |
| 18 | Ga0466720_039891 | 3300042607 | Bacteria | 5205 |
| 19 | Ga0466720_105381 | 3300042607 | Bacteria | 12327 |
| 20 | Ga0466722_069260 | 3300042609 | Bacteria | 3477 |
| 21 | Ga0466715_529822 | 3300042616 | Bacteria | 1483 |
| 22 | Ga0466718_022486 | 3300042617 | Bacteria | 1639 |
| 23 | Ga0466723_328813 | 3300042618 | Unclassified | 1139 |
| 24 | AustNasuHG_c1051744 | 3300000089 | Bacteria | 870 |
| 25 | JGI24698J34947_10117374 | 3300002449 | Bacteria | 1162 |
| 26 | JGI24702J35022_10758419 | 3300002462 | Bacteria | 604 |
| 27 | Ga0466703_005981 | 3300042636 | Bacteria | 16853 |
| 28 | Ga0466703_325115 | 3300042636 | Bacteria | 26641 |
| 29 | Ga0466704_484523 | 3300042643 | Bacteria | 5505 |
| 30 | Ga0466704_584984 | 3300042643 | Unclassified | 2743 |
| 31 | Ga0466690_430254 | 3300042590 | Bacteria | 1338 |
| 32 | Ga0466694_077432 | 3300042594 | Bacteria | 3939 |
| 33 | Ga0466694_091526 | 3300042594 | Bacteria | 17966 |
| 34 | Ga0466694_238189 | 3300042594 | Bacteria | 1814 |
| 35 | Ga0466722_227185 | 3300042609 | Unclassified | 1831 |
| 36 | Ga0466698_224810 | 3300042610 | Bacteria | 3394 |
| 37 | Ga0466711_227096 | 3300042615 | Bacteria | 4390 |
| 38 | Ga0466711_357650 | 3300042615 | Bacteria | 2040 |
| 39 | Ga0466715_494369 | 3300042616 | Bacteria | 3781 |
| 40 | Ga0466718_008574 | 3300042617 | Bacteria | 15835 |
| 41 | Ga0466726_417842 | 3300042619 | Bacteria | 1008 |
| 42 | Ga0466705_133264 | 3300042612 | Bacteria | 1385 |
| 43 | Ga0466732_150805 | 3300042656 | Bacteria | 5478 |
| 44 | Ga0466703_112157 | 3300042636 | Bacteria | 1789 |
| 45 | Ga0466709_183389 | 3300042648 | Bacteria | 3906 |
| 46 | Ga0466708_005306 | 3300042652 | Bacteria | 20730 |
| 47 | Ga0466690_063947 | 3300042590 | Bacteria | 4570 |
| 48 | Ga0466690_130954 | 3300042590 | Bacteria | 6460 |
| 49 | Ga0466690_299999 | 3300042590 | Bacteria | 3295 |
| 50 | Ga0466694_309192 | 3300042594 | Bacteria | 1384 |
| 51 | Ga0466696_133449 | 3300042596 | Unclassified | 2107 |
| 52 | Ga0466699_139472 | 3300042597 | Bacteria | 7819 |
| 53 | Ga0466712_249331 | 3300042614 | Bacteria | 6046 |
| 54 | Ga0466718_089817 | 3300042617 | Bacteria | 10246 |
| 55 | Ga0466723_046493 | 3300042618 | Bacteria | 1367 |
| 56 | Ga0466723_128499 | 3300042618 | Bacteria | 8791 |
| 57 | Ga0466705_137644 | 3300042612 | Bacteria | 2674 |
| 58 | JGI24698J34947_10024144 | 3300002449 | Bacteria | 3248 |
| 59 | Ga0068302_10086847 | 3300005071 | Bacteria | 1453 |
| 60 | Ga0072941_1015823 | 3300005201 | Bacteria | 10240 |
| 61 | Ga0466703_080496 | 3300042636 | Bacteria | 5852 |
| 62 | Ga0466703_183545 | 3300042636 | Bacteria | 1278 |
| 63 | Ga0466704_309844 | 3300042643 | Bacteria | 4342 |
| 64 | Ga0466690_039379 | 3300042590 | Bacteria | 1375 |
| 65 | Ga0466719_269003 | 3300042606 | Unclassified | 1432 |
| 66 | Ga0466719_452373 | 3300042606 | Bacteria | 2014 |
| 67 | Ga0466719_539022 | 3300042606 | Bacteria | 3244 |
| 68 | Ga0466720_115804 | 3300042607 | Bacteria | 4275 |
| 69 | Ga0466723_304564 | 3300042618 | Bacteria | 3371 |
| 70 | Ga0466726_094121 | 3300042619 | Unclassified | 1646 |
| 71 | Ga0072941_1019520 | 3300005201 | Bacteria | 1650 |
| 72 | Ga0466702_161816 | 3300042635 | Unclassified | 6351 |
| 73 | Ga0466704_376571 | 3300042643 | Unclassified | 1820 |
| 74 | Ga0466709_246949 | 3300042648 | Bacteria | 8687 |
| 75 | Ga0264413_114917 | 3300024493 | Bacteria | 4692 |
| 76 | Ga0466694_274764 | 3300042594 | Bacteria | 43729 |
| 77 | Ga0466719_112960 | 3300042606 | Archaea | 4313 |
| 78 | Ga0466719_455857 | 3300042606 | Unclassified | 1814 |
| 79 | Ga0466722_176078 | 3300042609 | Bacteria | 1358 |
| 80 | Ga0466711_043801 | 3300042615 | Bacteria | 4658 |
| 81 | Ga0466711_090342 | 3300042615 | Bacteria | 2953 |
| 82 | Ga0466711_310365 | 3300042615 | Bacteria | 2887 |
| 83 | Ga0466726_350612 | 3300042619 | Unclassified | 1959 |
| 84 | Ga0466728_274087 | 3300042620 | Unclassified | 4128 |
| 85 | Ga0466705_310554 | 3300042612 | Bacteria | 5042 |
| 86 | FAAS_10657171 | 3300001880 | Unclassified | 503 |
| 87 | Ga0466691_155453 | 3300042593 | Unclassified | 3293 |
| 88 | Ga0466691_163817 | 3300042593 | Bacteria | 4841 |
| 89 | Ga0466699_083036 | 3300042597 | Bacteria | 30507 |
| 90 | Ga0466699_350995 | 3300042597 | Bacteria | 3706 |
| 91 | Ga0466720_180165 | 3300042607 | Bacteria | 12683 |
| 92 | Ga0466722_142252 | 3300042609 | Unclassified | 1576 |
| 93 | Ga0466722_225557 | 3300042609 | Bacteria | 1449 |
| 94 | Ga0466698_004016 | 3300042610 | Bacteria | 10442 |
| 95 | Ga0466718_014550 | 3300042617 | Unclassified | 3101 |
| 96 | Ga0466726_208506 | 3300042619 | Bacteria | 31429 |
| 97 | AustNasuHG_c1004060 | 3300000089 | Unclassified | 5269 |
| 98 | Ga0264413_106608 | 3300024493 | Bacteria | 7835 |
| 99 | Ga0264413_118140 | 3300024493 | Bacteria | 4282 |
| 100 | Ga0466690_134758 | 3300042590 | Bacteria | 1148 |
| 101 | Ga0466690_148007 | 3300042590 | Bacteria | 1983 |
| 102 | Ga0466694_263382 | 3300042594 | Bacteria | 2807 |
| 103 | Ga0466712_037334 | 3300042614 | Bacteria | 17662 |
| 104 | Ga0466712_317902 | 3300042614 | Bacteria | 9854 |
| 105 | Ga0466715_629284 | 3300042616 | Bacteria | 1024 |
| 106 | Ga0466718_025181 | 3300042617 | Bacteria | 13026 |
| 107 | Ga0466702_369225 | 3300042635 | Bacteria | 2239 |
| 108 | Ga0466702_383089 | 3300042635 | Bacteria | 1567 |
| 109 | Ga0466703_059567 | 3300042636 | Bacteria | 2532 |
| 110 | Ga0466708_139412 | 3300042652 | Bacteria | 1196 |
| 111 | Ga0466699_018090 | 3300042597 | Bacteria | 12167 |
| 112 | Ga0466699_082670 | 3300042597 | Bacteria | 4442 |
| 113 | Ga0466716_141582 | 3300042605 | Bacteria | 1332 |
| 114 | Ga0466719_115481 | 3300042606 | Bacteria | 2524 |
| 115 | Ga0466698_288863 | 3300042610 | Bacteria | 2060 |
| 116 | Ga0466723_098302 | 3300042618 | Bacteria | 3414 |
| 117 | Ga0466726_437301 | 3300042619 | Bacteria | 6817 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF03852 | Vsr | DNA mismatch endonuclease Vsr | 3 | 72 | 0.95 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.