Protein Family IF07458
Metagenome
Isolate
151
Members
37
Samples
149
Scaffolds
145.96
Avg Length
Representative Sequence
- ID
- 3300042615|Ga0466711_048134|Ga0466711_048134_19203_19730
- Length
- 175 aa
- Sequence
- MDKWEAFPKFQFLGKLPWIHGSQKCRFKEVCMLIGVAPVISPELLDALFRMGHGDELVLADAFFPGDSCNSRVIRADGIKVVPLLEGILSLINLDYAVPHPVAMMAAGAGDSLDPSVAASYRAVIDRLWPGTPSIELVERFAFYERTQKAYAVVMTGETVKYGNIILKKGVIPVN
Sample Types
Isolate
1.3%
Metagenome
98.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
29.7%
Unclassified
13.5%
Rhinotermitidae
10.8%
Termopsidae
8.1%
Taxonomy
Archaea
0
Bacteria
126
Eukaryota
0
Viruses
0
Unclassified
25
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 4 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 5 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 12 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 16 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 17 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 25 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 26 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 31 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 32 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 33 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 34 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_106786 | 3300042659 | Bacteria | 1797 |
| 2 | Ga0466690_244046 | 3300042590 | Unclassified | 2205 |
| 3 | Ga0466690_296019 | 3300042590 | Bacteria | 2763 |
| 4 | Ga0466692_041368 | 3300042591 | Bacteria | 3065 |
| 5 | Ga0466691_012247 | 3300042593 | Bacteria | 7284 |
| 6 | Ga0466691_096478 | 3300042593 | Bacteria | 16481 |
| 7 | Ga0466729_204783 | 3300042621 | Bacteria | 1700 |
| 8 | Ga0466702_061710 | 3300042635 | Bacteria | 1109 |
| 9 | Ga0466703_015797 | 3300042636 | Bacteria | 2048 |
| 10 | Ga0466703_147935 | 3300042636 | Bacteria | 4914 |
| 11 | Ga0466704_001416 | 3300042643 | Bacteria | 1730 |
| 12 | Ga0466709_063703 | 3300042648 | Bacteria | 17406 |
| 13 | Ga0466709_092933 | 3300042648 | Bacteria | 51358 |
| 14 | Ga0466708_115407 | 3300042652 | Bacteria | 6000 |
| 15 | Ga0466727_302484 | 3300042655 | Bacteria | 3068 |
| 16 | Ga0466705_409230 | 3300042612 | Bacteria | 8989 |
| 17 | Ga0466711_039370 | 3300042615 | Bacteria | 4018 |
| 18 | Ga0466711_052754 | 3300042615 | Bacteria | 2014 |
| 19 | Ga0466711_070220 | 3300042615 | Bacteria | 8602 |
| 20 | Ga0466715_587431 | 3300042616 | Bacteria | 1009 |
| 21 | Ga0466723_009818 | 3300042618 | Bacteria | 36345 |
| 22 | Ga0466723_336584 | 3300042618 | Bacteria | 4192 |
| 23 | Ga0466728_176460 | 3300042620 | Unclassified | 1776 |
| 24 | Ga0466719_485846 | 3300042606 | Unclassified | 4122 |
| 25 | Ga0466722_226405 | 3300042609 | Bacteria | 1068 |
| 26 | Ga0466705_358346 | 3300042612 | Bacteria | 5915 |
| 27 | Ga0456237_0016749 | 3300041968 | Bacteria | 1032 |
| 28 | Ga0466690_011010 | 3300042590 | Bacteria | 2498 |
| 29 | Ga0466691_107496 | 3300042593 | Bacteria | 7546 |
| 30 | Ga0466696_011026 | 3300042596 | Bacteria | 16145 |
| 31 | Ga0466703_365693 | 3300042636 | Bacteria | 4842 |
| 32 | Ga0466704_064684 | 3300042643 | Bacteria | 7786 |
| 33 | Ga0466704_166755 | 3300042643 | Unclassified | 1763 |
| 34 | Ga0466709_204130 | 3300042648 | Bacteria | 2256 |
| 35 | Ga0466708_049595 | 3300042652 | Bacteria | 1404 |
| 36 | Ga0466711_136278 | 3300042615 | Bacteria | 1562 |
| 37 | Ga0466729_172145 | 3300042621 | Bacteria | 4746 |
| 38 | Ga0466707_265938 | 3300042601 | Bacteria | 2231 |
| 39 | Ga0466722_104864 | 3300042609 | Bacteria | 1402 |
| 40 | Ga0068305_10650842 | 3300005083 | Bacteria | 21143 |
| 41 | Ga0466699_131522 | 3300042597 | Bacteria | 1146 |
| 42 | Ga0466704_106150 | 3300042643 | Unclassified | 1128 |
| 43 | Ga0466704_280975 | 3300042643 | Bacteria | 5487 |
| 44 | Ga0466704_313156 | 3300042643 | Bacteria | 14137 |
| 45 | Ga0466704_407981 | 3300042643 | Bacteria | 1254 |
| 46 | Ga0466709_115047 | 3300042648 | Bacteria | 1047 |
| 47 | Ga0466727_081797 | 3300042655 | Bacteria | 4429 |
| 48 | Ga0466705_414582 | 3300042612 | Unclassified | 1134 |
| 49 | Ga0466711_048134 | 3300042615 | Bacteria | 22667 |
| 50 | Ga0466726_140325 | 3300042619 | Bacteria | 1456 |
| 51 | Ga0466726_461238 | 3300042619 | Unclassified | 1347 |
| 52 | Ga0466716_182552 | 3300042605 | Bacteria | 4361 |
| 53 | Ga0466722_091217 | 3300042609 | Bacteria | 2409 |
| 54 | JGI24695J34938_10025229 | 3300002450 | Bacteria | 2844 |
| 55 | Ga0466694_017441 | 3300042594 | Bacteria | 2937 |
| 56 | Ga0466704_258184 | 3300042643 | Unclassified | 19285 |
| 57 | Ga0466708_070767 | 3300042652 | Bacteria | 16624 |
| 58 | Ga0466727_141279 | 3300042655 | Bacteria | 1617 |
| 59 | Ga0466711_159767 | 3300042615 | Bacteria | 5008 |
| 60 | Ga0466715_180083 | 3300042616 | Bacteria | 3647 |
| 61 | Ga0466715_579709 | 3300042616 | Bacteria | 1105 |
| 62 | Ga0466715_637698 | 3300042616 | Unclassified | 1109 |
| 63 | Ga0466723_038238 | 3300042618 | Bacteria | 3643 |
| 64 | Ga0466723_076659 | 3300042618 | Bacteria | 1561 |
| 65 | Ga0466723_110396 | 3300042618 | Bacteria | 1871 |
| 66 | Ga0466726_069551 | 3300042619 | Bacteria | 1267 |
| 67 | Ga0466719_238642 | 3300042606 | Bacteria | 27025 |
| 68 | Ga0466722_177681 | 3300042609 | Bacteria | 3098 |
| 69 | Ga0466698_428103 | 3300042610 | Bacteria | 1056 |
| 70 | Ga0466705_186989 | 3300042612 | Bacteria | 6606 |
| 71 | Ga0466693_333808 | 3300042592 | Bacteria | 12866 |
| 72 | Ga0466691_028941 | 3300042593 | Bacteria | 9618 |
| 73 | Ga0466703_087393 | 3300042636 | Bacteria | 12042 |
| 74 | Ga0466703_209439 | 3300042636 | Bacteria | 17765 |
| 75 | Ga0466703_322675 | 3300042636 | Bacteria | 7728 |
| 76 | Ga0466704_425211 | 3300042643 | Bacteria | 1577 |
| 77 | Ga0466715_103904 | 3300042616 | Unclassified | 1643 |
| 78 | Ga0466719_299456 | 3300042606 | Bacteria | 1120 |
| 79 | JGI24702J35022_10726750 | 3300002462 | Unclassified | 618 |
| 80 | Ga0466705_016669 | 3300042612 | Unclassified | 1456 |
| 81 | Ga0466692_053105 | 3300042591 | Bacteria | 1426 |
| 82 | Ga0466691_065869 | 3300042593 | Bacteria | 15045 |
| 83 | Ga0466699_247889 | 3300042597 | Bacteria | 1056 |
| 84 | Ga0466703_343792 | 3300042636 | Bacteria | 4745 |
| 85 | Ga0466704_231718 | 3300042643 | Bacteria | 7780 |
| 86 | Ga0466709_159605 | 3300042648 | Bacteria | 9056 |
| 87 | Ga0466708_007791 | 3300042652 | Unclassified | 1193 |
| 88 | Ga0466708_132390 | 3300042652 | Bacteria | 4118 |
| 89 | Ga0466708_155489 | 3300042652 | Unclassified | 3025 |
| 90 | Ga0466727_000052 | 3300042655 | Bacteria | 1200 |
| 91 | Ga0466727_258267 | 3300042655 | Bacteria | 1828 |
| 92 | Ga0466727_259773 | 3300042655 | Bacteria | 9380 |
| 93 | Ga0466705_441109 | 3300042612 | Bacteria | 11408 |
| 94 | Ga0466712_179083 | 3300042614 | Bacteria | 6745 |
| 95 | Ga0466715_527334 | 3300042616 | Bacteria | 4524 |
| 96 | Ga0466723_294357 | 3300042618 | Unclassified | 4848 |
| 97 | Ga0466728_202227 | 3300042620 | Unclassified | 1571 |
| 98 | Ga0466716_406417 | 3300042605 | Bacteria | 13086 |
| 99 | Ga0466716_418898 | 3300042605 | Unclassified | 1265 |
| 100 | JGI24702J35022_10002522 | 3300002462 | Bacteria | 11145 |
| 101 | JGI24702J35022_10018620 | 3300002462 | Bacteria | 3783 |
| 102 | Ga0466705_064783 | 3300042612 | Unclassified | 1716 |
| 103 | Ga0466705_114482 | 3300042612 | Unclassified | 10233 |
| 104 | Ga0466691_219748 | 3300042593 | Bacteria | 5260 |
| 105 | Ga0466703_081809 | 3300042636 | Bacteria | 1995 |
| 106 | Ga0466703_423564 | 3300042636 | Bacteria | 21932 |
| 107 | Ga0466709_142018 | 3300042648 | Bacteria | 10268 |
| 108 | Ga0466709_172404 | 3300042648 | Bacteria | 8598 |
| 109 | Ga0466708_103207 | 3300042652 | Bacteria | 1729 |
| 110 | Ga0466708_190051 | 3300042652 | Bacteria | 4596 |
| 111 | Ga0466727_012949 | 3300042655 | Bacteria | 4441 |
| 112 | Ga0466727_216725 | 3300042655 | Bacteria | 1366 |
| 113 | Ga0123356_10935560 | 3300010049 | Bacteria | 1038 |
| 114 | Ga0123356_11636855 | 3300010049 | Bacteria | 797 |
| 115 | Ga0123356_12011467 | 3300010049 | Unclassified | 721 |
| 116 | Ga0466715_097347 | 3300042616 | Bacteria | 3205 |
| 117 | Ga0466715_148789 | 3300042616 | Bacteria | 16243 |
| 118 | Ga0466715_557818 | 3300042616 | Bacteria | 10534 |
| 119 | Ga0466723_082453 | 3300042618 | Bacteria | 72592 |
| 120 | Ga0466723_355251 | 3300042618 | Unclassified | 1399 |
| 121 | Ga0466726_145335 | 3300042619 | Unclassified | 1307 |
| 122 | Ga0466728_183455 | 3300042620 | Bacteria | 2943 |
| 123 | Ga0466728_198737 | 3300042620 | Unclassified | 2400 |
| 124 | Ga0466722_039399 | 3300042609 | Bacteria | 3164 |
| 125 | Ga0068302_10227131 | 3300005071 | Bacteria | 1165 |
| 126 | Ga0466705_121859 | 3300042612 | Unclassified | 11501 |
| 127 | Ga0466690_042301 | 3300042590 | Bacteria | 1958 |
| 128 | Ga0466690_122739 | 3300042590 | Bacteria | 16947 |
| 129 | Ga0466692_001220 | 3300042591 | Bacteria | 1397 |
| 130 | Ga0466696_043963 | 3300042596 | Bacteria | 2377 |
| 131 | Ga0466696_094412 | 3300042596 | Bacteria | 14144 |
| 132 | Ga0466704_170928 | 3300042643 | Bacteria | 2720 |
| 133 | Ga0466704_445650 | 3300042643 | Bacteria | 3306 |
| 134 | Ga0466727_252452 | 3300042655 | Bacteria | 1103 |
| 135 | Ga0466727_296891 | 3300042655 | Bacteria | 1218 |
| 136 | Ga0123356_10354925 | 3300010049 | Bacteria | 1591 |
| 137 | Ga0466711_237418 | 3300042615 | Bacteria | 30259 |
| 138 | Ga0466711_407922 | 3300042615 | Bacteria | 7680 |
| 139 | Ga0466715_045951 | 3300042616 | Bacteria | 16753 |
| 140 | Ga0466715_068985 | 3300042616 | Bacteria | 29330 |
| 141 | Ga0466723_051024 | 3300042618 | Unclassified | 3387 |
| 142 | Ga0466728_201895 | 3300042620 | Bacteria | 3013 |
| 143 | Ga0466728_219372 | 3300042620 | Bacteria | 1456 |
| 144 | Ga0466728_317741 | 3300042620 | Bacteria | 1244 |
| 145 | Ga0466707_030047 | 3300042601 | Bacteria | 1369 |
| 146 | Ga0466707_092165 | 3300042601 | Bacteria | 1163 |
| 147 | Ga0466713_007325 | 3300042602 | Bacteria | 5186 |
| 148 | Ga0466720_155414 | 3300042607 | Bacteria | 2177 |
| 149 | JGI24695J34938_10001471 | 3300002450 | Bacteria | 19909 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05025 | RbsD_FucU | RbsD / FucU transport protein family | 37 | 172 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.