Protein Family IF07436
Metagenome
Isolate
129
Members
48
Samples
119
Scaffolds
360.53
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_317354|Ga0466712_317354_8999_10093
- Length
- 344 aa
- Sequence
- MAEYRQIDTKKAKAFCEALFRAYGFSSDESERITDVLIRADLYGIESHGVQRLVRYNEEITSGMVDVKAKPQTVHETGVSACVDANKAMGQLAAAQGMKLAIKKARTCGCGMVTVRNSNHYGIASYYTEMAAAEDFIGLCMTNTEAICVPTFGSQLALAMPADPFTFSYDASTTVVPRGTLEVYRKNGTPLPEHWALDADGKPCTDAAVVIDNIIAKAGGGINPLGGMGIANGGHKGYGLSIIVDLFSAVLSGGLTSNYVNRKPGLNGICHYFMAIDYGVFGDKAAIKANMSKFLQELRDSKKAQGCTRIFTHGEKEAEMKERRINSQIPVNEKTLAESLLWPS
Sample Types
Isolate
7.8%
Metagenome
92.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.7%
Kalotermitidae
23.9%
Unclassified
21.7%
Rhinotermitidae
6.5%
Termopsidae
2.2%
Taxonomy
Archaea
0
Bacteria
117
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 2 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 3 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 6 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 7 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 14 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 15 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 19 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 22 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 23 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 24 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 25 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 26 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 27 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 28 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 29 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 30 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 31 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 32 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 33 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 34 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 35 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 36 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 37 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 38 | 2820483401 | Unclassified Firmicutes Lab288P1bin74 | Isolate | Unclassified |
| 39 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 40 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 41 | 2228664003 | P3 Gut Segment Termite Single Cell Genome_Treponema sp. T4b from Florida, USA | Metagenome | Termitidae |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10000558 | 3300010049 | Bacteria | 41407 |
| 2 | Ga0466702_271925 | 3300042635 | Bacteria | 8460 |
| 3 | Ga0466716_087456 | 3300042605 | Bacteria | 11989 |
| 4 | Ga0466698_371872 | 3300042610 | Bacteria | 2072 |
| 5 | Ga0415639_013206 | 3300038395 | Bacteria | 15801 |
| 6 | Ga0466692_116261 | 3300042591 | Bacteria | 4341 |
| 7 | Ga0466699_202189 | 3300042597 | Bacteria | 26685 |
| 8 | Ga0466712_046018 | 3300042614 | Bacteria | 3256 |
| 9 | Ga0466712_317354 | 3300042614 | Bacteria | 11761 |
| 10 | Ga0466726_023252 | 3300042619 | Bacteria | 1651 |
| 11 | Ga0466732_160823 | 3300042656 | Bacteria | 9861 |
| 12 | Ga0123356_10002604 | 3300010049 | Bacteria | 19222 |
| 13 | Ga0123356_10004450 | 3300010049 | Bacteria | 14493 |
| 14 | Ga0123353_10217185 | 3300010167 | Bacteria | 2994 |
| 15 | Ga0123353_10469838 | 3300010167 | Bacteria | 1845 |
| 16 | Ga0466731_031532 | 3300042622 | Unclassified | 1482 |
| 17 | Ga0466722_064257 | 3300042609 | Bacteria | 17947 |
| 18 | Ga0466722_128753 | 3300042609 | Bacteria | 10433 |
| 19 | Ga0466692_082185 | 3300042591 | Bacteria | 1512 |
| 20 | Ga0466691_026793 | 3300042593 | Bacteria | 6494 |
| 21 | Ga0466712_024868 | 3300042614 | Unclassified | 2095 |
| 22 | JGI24698J34947_10039666 | 3300002449 | Unclassified | 2436 |
| 23 | JGI24695J34938_10003285 | 3300002450 | Bacteria | 11401 |
| 24 | JGI24702J35022_10075918 | 3300002462 | Bacteria | 1816 |
| 25 | Ga0072941_1002524 | 3300005201 | Bacteria | 35795 |
| 26 | Ga0123353_10016176 | 3300010167 | Bacteria | 10887 |
| 27 | Ga0466731_154467 | 3300042622 | Bacteria | 5379 |
| 28 | Ga0466731_243466 | 3300042622 | Bacteria | 6892 |
| 29 | Ga0466731_391993 | 3300042622 | Bacteria | 1214 |
| 30 | Ga0466730_012198 | 3300042625 | Bacteria | 2488 |
| 31 | Ga0466722_252344 | 3300042609 | Bacteria | 4076 |
| 32 | Ga0264413_130328 | 3300024493 | Bacteria | 7865 |
| 33 | Ga0466690_324918 | 3300042590 | Bacteria | 2294 |
| 34 | Ga0466694_384081 | 3300042594 | Bacteria | 2086 |
| 35 | Ga0466712_028790 | 3300042614 | Bacteria | 127971 |
| 36 | Ga0466718_069629 | 3300042617 | Bacteria | 2235 |
| 37 | Ga0466718_102388 | 3300042617 | Bacteria | 2409 |
| 38 | Ga0466723_275797 | 3300042618 | Bacteria | 3649 |
| 39 | Ga0466726_277799 | 3300042619 | Bacteria | 1605 |
| 40 | Ga0466728_019011 | 3300042620 | Bacteria | 5127 |
| 41 | JGI24698J34947_10070363 | 3300002449 | Unclassified | 1684 |
| 42 | Ga0072941_1008435 | 3300005201 | Bacteria | 12003 |
| 43 | Ga0072941_1020615 | 3300005201 | Bacteria | 34462 |
| 44 | Ga0123356_10289508 | 3300010049 | Bacteria | 1737 |
| 45 | Ga0466690_074725 | 3300042590 | Bacteria | 3966 |
| 46 | Ga0466692_183475 | 3300042591 | Bacteria | 4316 |
| 47 | Ga0466693_385425 | 3300042592 | Bacteria | 15880 |
| 48 | Ga0466712_003946 | 3300042614 | Unclassified | 1614 |
| 49 | Ga0466712_205998 | 3300042614 | Bacteria | 15354 |
| 50 | Ga0466715_221961 | 3300042616 | Bacteria | 9898 |
| 51 | JGI24698J34947_10007518 | 3300002449 | Bacteria | 5986 |
| 52 | JGI24695J34938_10000081 | 3300002450 | Bacteria | 82371 |
| 53 | JGI24695J34938_10038168 | 3300002450 | Bacteria | 2177 |
| 54 | JGI24702J35022_10005080 | 3300002462 | Bacteria | 7740 |
| 55 | Ga0123357_10000329 | 3300009784 | Bacteria | 44916 |
| 56 | Ga0123353_10183380 | 3300010167 | Bacteria | 3311 |
| 57 | Ga0466704_053681 | 3300042643 | Unclassified | 2637 |
| 58 | Ga0466709_026164 | 3300042648 | Bacteria | 20973 |
| 59 | Ga0466719_061756 | 3300042606 | Bacteria | 7163 |
| 60 | Ga0466698_146511 | 3300042610 | Bacteria | 2525 |
| 61 | Ga0466690_219739 | 3300042590 | Bacteria | 1853 |
| 62 | Ga0466712_027839 | 3300042614 | Unclassified | 5000 |
| 63 | Ga0466718_028686 | 3300042617 | Bacteria | 1492 |
| 64 | AustNasuHG_c1003791 | 3300000089 | Bacteria | 5448 |
| 65 | JGI24698J34947_10008906 | 3300002449 | Bacteria | 5508 |
| 66 | JGI24698J34947_10023293 | 3300002449 | Bacteria | 3313 |
| 67 | Ga0466705_126340 | 3300042612 | Unclassified | 1298 |
| 68 | Ga0466720_176332 | 3300042607 | Bacteria | 2915 |
| 69 | Ga0466722_198443 | 3300042609 | Bacteria | 2571 |
| 70 | Ga0466696_300948 | 3300042596 | Bacteria | 11969 |
| 71 | Ga0466712_123751 | 3300042614 | Bacteria | 21596 |
| 72 | Ga0466712_130948 | 3300042614 | Bacteria | 7892 |
| 73 | Ga0466712_207563 | 3300042614 | Bacteria | 94540 |
| 74 | Ga0466715_142610 | 3300042616 | Bacteria | 2518 |
| 75 | Ga0466718_025188 | 3300042617 | Bacteria | 4963 |
| 76 | Ga0466723_151504 | 3300042618 | Bacteria | 33081 |
| 77 | 2230954247 | 2228664003 | Bacteria | 6070 |
| 78 | JGI24695J34938_10000221 | 3300002450 | Bacteria | 54408 |
| 79 | JGI24695J34938_10003002 | 3300002450 | Bacteria | 12137 |
| 80 | JGI24695J34938_10003656 | 3300002450 | Unclassified | 10546 |
| 81 | Ga0123356_10281890 | 3300010049 | Bacteria | 1757 |
| 82 | Ga0123353_10133356 | 3300010167 | Bacteria | 3985 |
| 83 | Ga0123353_10298253 | 3300010167 | Bacteria | 2462 |
| 84 | Ga0466702_040206 | 3300042635 | Bacteria | 3512 |
| 85 | Ga0415639_056024 | 3300038395 | Bacteria | 14269 |
| 86 | Ga0456237_0005883 | 3300041968 | Bacteria | 1936 |
| 87 | Ga0466690_060970 | 3300042590 | Unclassified | 1920 |
| 88 | Ga0466694_167556 | 3300042594 | Bacteria | 2593 |
| 89 | Ga0466699_162663 | 3300042597 | Bacteria | 4339 |
| 90 | Ga0466712_300983 | 3300042614 | Bacteria | 1430 |
| 91 | Ga0466718_037435 | 3300042617 | Bacteria | 3969 |
| 92 | Ga0466723_052661 | 3300042618 | Unclassified | 4130 |
| 93 | Ga0466728_443495 | 3300042620 | Bacteria | 3028 |
| 94 | AustNasuHG_c1000971 | 3300000089 | Bacteria | 10323 |
| 95 | AustNasuHG_c1017854 | 3300000089 | Bacteria | 2350 |
| 96 | JGI24698J34947_10000116 | 3300002449 | Bacteria | 28135 |
| 97 | JGI24698J34947_10037552 | 3300002449 | Bacteria | 2515 |
| 98 | JGI24695J34938_10000780 | 3300002450 | Bacteria | 29857 |
| 99 | JGI24695J34938_10003329 | 3300002450 | Bacteria | 11314 |
| 100 | Ga0072941_1020614 | 3300005201 | Bacteria | 2203 |
| 101 | Ga0466705_027000 | 3300042612 | Bacteria | 3980 |
| 102 | Ga0466732_252561 | 3300042656 | Bacteria | 5137 |
| 103 | Ga0123356_10003865 | 3300010049 | Bacteria | 15607 |
| 104 | Ga0123353_10636684 | 3300010167 | Bacteria | 1513 |
| 105 | Ga0466704_333125 | 3300042643 | Unclassified | 1239 |
| 106 | Ga0466709_369424 | 3300042648 | Bacteria | 7898 |
| 107 | Ga0466700_190210 | 3300042600 | Bacteria | 14958 |
| 108 | Ga0466716_323152 | 3300042605 | Bacteria | 2585 |
| 109 | Ga0466690_140887 | 3300042590 | Bacteria | 2059 |
| 110 | Ga0466692_129748 | 3300042591 | Bacteria | 3506 |
| 111 | Ga0466692_173557 | 3300042591 | Bacteria | 1229 |
| 112 | Ga0466691_066069 | 3300042593 | Bacteria | 10035 |
| 113 | Ga0466691_181309 | 3300042593 | Bacteria | 6611 |
| 114 | Ga0466699_175215 | 3300042597 | Bacteria | 16971 |
| 115 | Ga0466718_073447 | 3300042617 | Bacteria | 17295 |
| 116 | Ga0466718_117052 | 3300042617 | Bacteria | 3770 |
| 117 | JGI24695J34938_10000899 | 3300002450 | Bacteria | 27480 |
| 118 | JGI24702J35022_10013559 | 3300002462 | Bacteria | 4513 |
| 119 | Ga0072941_1032448 | 3300005201 | Bacteria | 3913 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02615 | Ldh_2 | Malate/L-lactate dehydrogenase | 8 | 337 | 0.95 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02615 | GO:0016491 | oxidoreductase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.