Protein Family IF07429
Metagenome
Metatranscriptome
Isolate
155
Members
42
Samples
149
Scaffolds
134.06
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_295715|Ga0466712_295715_378_845
- Length
- 155 aa
- Sequence
- LGVNIFFQIWFTKVEECMADSKIEQYLIDLMITYQQIDSNLWLLDDAERSLQGVAVMQAEPLVIIRAEIMDVPEKNLLELYTKLLELNAADIIHGAYALENGKIVLIDTLQYETMDYEDFRASLDSFSLALTQHYPILSKFRNKSSSAKTEGVGA
Sample Types
Isolate
3.9%
Metagenome
93.5%
MAG
0.0%
Metatranscriptome
2.6%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
52.5%
Kalotermitidae
20.0%
Unclassified
17.5%
Rhinotermitidae
5.0%
Termopsidae
5.0%
Taxonomy
Archaea
1
Bacteria
146
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 7 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 8 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 9 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 10 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 11 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 12 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 13 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 14 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 15 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 16 | 3300021217 | Termite gut microbial communities from nest from French Guiana - 13-5 mRNA SA | Metatranscriptome | Termitidae |
| 17 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 18 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 19 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 26 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 27 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 28 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 31 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 32 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 33 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 34 | 3300022815 | Termite gut microbial communities from Microcerotermes sp. nest - French Guiana - 27-16 mRNA | Metatranscriptome | Termitidae |
| 35 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 36 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 42 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_327417 | 3300042601 | Bacteria | 1287 |
| 2 | Ga0466722_203940 | 3300042609 | Bacteria | 1249 |
| 3 | Ga0466722_233447 | 3300042609 | Bacteria | 4265 |
| 4 | Ga0466712_025166 | 3300042614 | Bacteria | 29267 |
| 5 | Ga0466712_127078 | 3300042614 | Bacteria | 4524 |
| 6 | Ga0466718_015004 | 3300042617 | Bacteria | 2370 |
| 7 | Ga0466718_135767 | 3300042617 | Bacteria | 1622 |
| 8 | Ga0466718_156066 | 3300042617 | Bacteria | 14516 |
| 9 | Ga0415639_151638 | 3300038395 | Bacteria | 2260 |
| 10 | Ga0466693_128816 | 3300042592 | Bacteria | 39215 |
| 11 | Ga0466694_245632 | 3300042594 | Bacteria | 3168 |
| 12 | Ga0466694_372586 | 3300042594 | Archaea | 1326 |
| 13 | Ga0123356_10051009 | 3300010049 | Bacteria | 3849 |
| 14 | Ga0123353_10350061 | 3300010167 | Bacteria | 2226 |
| 15 | AustNasuHG_c1014911 | 3300000089 | Bacteria | 2632 |
| 16 | AustNasuHG_c1037658 | 3300000089 | Bacteria | 1231 |
| 17 | JGI24698J34947_10020314 | 3300002449 | Bacteria | 3579 |
| 18 | JGI24695J34938_10001087 | 3300002450 | Bacteria | 24560 |
| 19 | JGI24695J34938_10001741 | 3300002450 | Bacteria | 17998 |
| 20 | Ga0466732_242271 | 3300042656 | Bacteria | 2328 |
| 21 | Ga0466712_052756 | 3300042614 | Bacteria | 3817 |
| 22 | Ga0466712_054962 | 3300042614 | Unclassified | 1622 |
| 23 | Ga0466712_085549 | 3300042614 | Bacteria | 13086 |
| 24 | Ga0466712_295715 | 3300042614 | Bacteria | 19331 |
| 25 | Ga0255786_1010864 | 3300022815 | Bacteria | 551 |
| 26 | Ga0264413_120038 | 3300024493 | Bacteria | 4580 |
| 27 | Ga0264413_121839 | 3300024493 | Bacteria | 11656 |
| 28 | Ga0466694_112830 | 3300042594 | Bacteria | 10883 |
| 29 | Ga0466694_161930 | 3300042594 | Bacteria | 4706 |
| 30 | Ga0466694_307475 | 3300042594 | Bacteria | 21455 |
| 31 | Ga0466694_326245 | 3300042594 | Bacteria | 16810 |
| 32 | Ga0123353_11261235 | 3300010167 | Bacteria | 963 |
| 33 | AustNasuHG_c1001254 | 3300000089 | Bacteria | 9142 |
| 34 | AustNasuHG_c1012210 | 3300000089 | Bacteria | 2967 |
| 35 | JGI24698J34947_10090416 | 3300002449 | Bacteria | 1406 |
| 36 | Ga0072941_1004164 | 3300005201 | Bacteria | 30841 |
| 37 | Ga0466702_253457 | 3300042635 | Bacteria | 3662 |
| 38 | Ga0466704_559417 | 3300042643 | Bacteria | 7617 |
| 39 | Ga0466732_179385 | 3300042656 | Bacteria | 2042 |
| 40 | Ga0466716_510263 | 3300042605 | Bacteria | 5461 |
| 41 | Ga0466720_080798 | 3300042607 | Bacteria | 12794 |
| 42 | Ga0466720_238149 | 3300042607 | Bacteria | 2995 |
| 43 | Ga0466712_117897 | 3300042614 | Bacteria | 17954 |
| 44 | Ga0466712_165328 | 3300042614 | Bacteria | 6120 |
| 45 | Ga0466712_279517 | 3300042614 | Bacteria | 2046 |
| 46 | Ga0466711_331138 | 3300042615 | Bacteria | 12026 |
| 47 | Ga0415639_063982 | 3300038395 | Bacteria | 3271 |
| 48 | Ga0466694_121828 | 3300042594 | Bacteria | 2993 |
| 49 | Ga0466699_383046 | 3300042597 | Bacteria | 1137 |
| 50 | Ga0123356_10013791 | 3300010049 | Bacteria | 7782 |
| 51 | JGI24698J34947_10015899 | 3300002449 | Unclassified | 4091 |
| 52 | JGI24698J34947_10022827 | 3300002449 | Bacteria | 3350 |
| 53 | JGI24698J34947_10032863 | 3300002449 | Bacteria | 2723 |
| 54 | JGI24698J34947_10085046 | 3300002449 | Bacteria | 1471 |
| 55 | JGI24695J34938_10137478 | 3300002450 | Bacteria | 997 |
| 56 | JGI24697J35500_11262821 | 3300002507 | Unclassified | 3160 |
| 57 | Ga0072940_1133418 | 3300005200 | Bacteria | 1584 |
| 58 | Ga0072941_1006160 | 3300005201 | Bacteria | 13501 |
| 59 | Ga0072941_1049849 | 3300005201 | Bacteria | 4125 |
| 60 | Ga0072941_1086448 | 3300005201 | Bacteria | 1457 |
| 61 | Ga0466732_305548 | 3300042656 | Unclassified | 3531 |
| 62 | Ga0466719_327434 | 3300042606 | Bacteria | 1545 |
| 63 | Ga0466712_079362 | 3300042614 | Bacteria | 2682 |
| 64 | Ga0466728_254681 | 3300042620 | Bacteria | 1062 |
| 65 | Ga0415639_001443 | 3300038395 | Bacteria | 16250 |
| 66 | Ga0466692_027550 | 3300042591 | Bacteria | 1514 |
| 67 | Ga0466699_048356 | 3300042597 | Bacteria | 14845 |
| 68 | Ga0123356_10851905 | 3300010049 | Bacteria | 1083 |
| 69 | Ga0123353_13168760 | 3300010167 | Bacteria | 528 |
| 70 | AustNasuHG_c1027004 | 3300000089 | Bacteria | 1770 |
| 71 | JGI24698J34947_10001617 | 3300002449 | Bacteria | 11980 |
| 72 | JGI24698J34947_10016994 | 3300002449 | Bacteria | 3946 |
| 73 | JGI24698J34947_10065451 | 3300002449 | Bacteria | 1772 |
| 74 | JGI24695J34938_10001209 | 3300002450 | Bacteria | 22895 |
| 75 | JGI24695J34938_10137562 | 3300002450 | Bacteria | 997 |
| 76 | Ga0072941_1013669 | 3300005201 | Bacteria | 4131 |
| 77 | Ga0466702_238078 | 3300042635 | Bacteria | 1141 |
| 78 | Ga0466703_001567 | 3300042636 | Bacteria | 3304 |
| 79 | Ga0466700_130617 | 3300042600 | Bacteria | 7791 |
| 80 | Ga0466712_140266 | 3300042614 | Bacteria | 1576 |
| 81 | Ga0466712_298014 | 3300042614 | Bacteria | 1488 |
| 82 | Ga0223687_114466 | 3300021217 | Bacteria | 1185 |
| 83 | Ga0264413_109280 | 3300024493 | Bacteria | 4861 |
| 84 | Ga0466694_017022 | 3300042594 | Bacteria | 2751 |
| 85 | Ga0466699_014366 | 3300042597 | Bacteria | 1455 |
| 86 | Ga0466699_203219 | 3300042597 | Bacteria | 25669 |
| 87 | Ga0123353_10007497 | 3300010167 | Bacteria | 14762 |
| 88 | Ga0123353_11055631 | 3300010167 | Bacteria | 1084 |
| 89 | JGI24698J34947_10044823 | 3300002449 | Bacteria | 2261 |
| 90 | JGI24695J34938_10000702 | 3300002450 | Bacteria | 31504 |
| 91 | JGI24695J34938_10004618 | 3300002450 | Bacteria | 8949 |
| 92 | JGI24695J34938_10016467 | 3300002450 | Bacteria | 3758 |
| 93 | JGI24695J34938_10021399 | 3300002450 | Bacteria | 3165 |
| 94 | Ga0072941_1002037 | 3300005201 | Bacteria | 4663 |
| 95 | Ga0072941_1013667 | 3300005201 | Bacteria | 1666 |
| 96 | Ga0466730_002288 | 3300042625 | Bacteria | 1240 |
| 97 | Ga0466730_091956 | 3300042625 | Bacteria | 1654 |
| 98 | Ga0466702_371125 | 3300042635 | Bacteria | 1016 |
| 99 | Ga0466702_383512 | 3300042635 | Bacteria | 4725 |
| 100 | Ga0466712_079045 | 3300042614 | Bacteria | 6980 |
| 101 | Ga0255786_1010865 | 3300022815 | Bacteria | 1197 |
| 102 | Ga0466692_037952 | 3300042591 | Bacteria | 1574 |
| 103 | Ga0466694_060532 | 3300042594 | Bacteria | 20244 |
| 104 | Ga0123356_10003423 | 3300010049 | Bacteria | 16620 |
| 105 | Ga0123356_11641270 | 3300010049 | Bacteria | 796 |
| 106 | Ga0123353_11995439 | 3300010167 | Bacteria | 711 |
| 107 | JGI24698J34947_10061022 | 3300002449 | Bacteria | 1858 |
| 108 | JGI24698J34947_10066084 | 3300002449 | Bacteria | 1760 |
| 109 | JGI24695J34938_10000211 | 3300002450 | Bacteria | 55384 |
| 110 | JGI24695J34938_10093038 | 3300002450 | Bacteria | 1236 |
| 111 | Ga0466702_450614 | 3300042635 | Bacteria | 1176 |
| 112 | Ga0466708_292401 | 3300042652 | Bacteria | 27290 |
| 113 | Ga0466727_342594 | 3300042655 | Bacteria | 1231 |
| 114 | Ga0466712_031620 | 3300042614 | Bacteria | 32683 |
| 115 | Ga0466712_044842 | 3300042614 | Bacteria | 11951 |
| 116 | Ga0466711_183309 | 3300042615 | Bacteria | 12879 |
| 117 | Ga0415639_020494 | 3300038395 | Bacteria | 5140 |
| 118 | Ga0466694_146836 | 3300042594 | Bacteria | 1200 |
| 119 | Ga0466699_066131 | 3300042597 | Bacteria | 2450 |
| 120 | Ga0123356_10000279 | 3300010049 | Bacteria | 58981 |
| 121 | Ga0123356_10003251 | 3300010049 | Bacteria | 17069 |
| 122 | Ga0123353_10235826 | 3300010167 | Bacteria | 2847 |
| 123 | AustNasuHG_c1001030 | 3300000089 | Bacteria | 10034 |
| 124 | AustNasuHG_c1006591 | 3300000089 | Unclassified | 4138 |
| 125 | JGI24698J34947_10016079 | 3300002449 | Unclassified | 4065 |
| 126 | JGI24698J34947_10018654 | 3300002449 | Bacteria | 3747 |
| 127 | JGI24698J34947_10025031 | 3300002449 | Bacteria | 3180 |
| 128 | JGI24698J34947_10071226 | 3300002449 | Bacteria | 1669 |
| 129 | JGI24695J34938_10000997 | 3300002450 | Bacteria | 25705 |
| 130 | Ga0072941_1043089 | 3300005201 | Unclassified | 3290 |
| 131 | Ga0466720_003874 | 3300042607 | Bacteria | 6273 |
| 132 | Ga0466722_164159 | 3300042609 | Bacteria | 6597 |
| 133 | Ga0466698_221453 | 3300042610 | Bacteria | 1450 |
| 134 | Ga0466718_032490 | 3300042617 | Bacteria | 24822 |
| 135 | Ga0466723_091699 | 3300042618 | Bacteria | 1612 |
| 136 | Ga0466726_397315 | 3300042619 | Bacteria | 1540 |
| 137 | Ga0255786_1010863 | 3300022815 | Unclassified | 848 |
| 138 | Ga0264413_109281 | 3300024493 | Bacteria | 8425 |
| 139 | Ga0466699_015744 | 3300042597 | Bacteria | 3237 |
| 140 | Ga0466699_023342 | 3300042597 | Bacteria | 3766 |
| 141 | Ga0466699_090803 | 3300042597 | Bacteria | 2517 |
| 142 | Ga0123356_10199493 | 3300010049 | Bacteria | 2039 |
| 143 | AustNasuHG_c1001824 | 3300000089 | Bacteria | 7703 |
| 144 | AustNasuHG_c1014223 | 3300000089 | Bacteria | 2711 |
| 145 | JGI24695J34938_10000033 | 3300002450 | Bacteria | 103928 |
| 146 | Ga0072940_1105844 | 3300005200 | Bacteria | 1310 |
| 147 | Ga0072941_1027785 | 3300005201 | Bacteria | 4075 |
| 148 | Ga0466702_276796 | 3300042635 | Bacteria | 4080 |
| 149 | Ga0466708_082775 | 3300042652 | Bacteria | 7838 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF22550 | CesT_Tir_1 | CesT_Tir_1 | 21 | 142 | 0.92 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.