Protein Family IF07378
Metagenome
Metatranscriptome
Isolate
132
Members
39
Samples
126
Scaffolds
198.23
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_124861|Ga0466712_124861_2620_3330
- Length
- 236 aa
- Sequence
- MYKVPAFESFVKGNFHFFENFLIFPGIAKWAKKRYADAMFNSIRGIVNEKGGETVFLLTGGLEWEIAMPATDIDLLPAAGGECRVFTWLYHREDLMRLFGFSGRARRDTFLELLKVEGIGPKNALKIMGGIGQEDLERALETGDLARLEAVPGLGKKTAQKMLLALKGKLVHESAASPADSPYGDLIEALAAMGYEKRAAAEAITRAEAGLPAGLAPAEKEKLLFKNAIVYLSSTL
Sample Types
Isolate
4.5%
Metagenome
94.7%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
45.9%
Unclassified
24.3%
Kalotermitidae
16.2%
Termopsidae
5.4%
Rhinotermitidae
5.4%
Hodotermitidae
2.7%
Taxonomy
Archaea
1
Bacteria
125
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 2 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 3 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 4 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 5 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 6 | 2781125633 | Treponema sp. Co191P1bin38 | Isolate | Unclassified |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300002507 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 | Metagenome | Termitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 12 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 13 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 14 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 17 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 18 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 21 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2781125640 | Treponema sp. Co191P1bin37 | Isolate | Unclassified |
| 33 | 2781125682 | Treponema sp. Lab288P1bin107 | Isolate | Unclassified |
| 34 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 35 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 36 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466699_057425 | 3300042597 | Bacteria | 13559 |
| 2 | Ga0466699_178493 | 3300042597 | Bacteria | 3910 |
| 3 | Ga0466699_206062 | 3300042597 | Bacteria | 2390 |
| 4 | JGI24695J34938_10010714 | 3300002450 | Bacteria | 4994 |
| 5 | Ga0072941_1005729 | 3300005201 | Bacteria | 49202 |
| 6 | Ga0466718_051934 | 3300042617 | Bacteria | 2738 |
| 7 | Ga0466723_051952 | 3300042618 | Bacteria | 20182 |
| 8 | Ga0123356_10043292 | 3300010049 | Bacteria | 4192 |
| 9 | Ga0123356_11010829 | 3300010049 | Bacteria | 1001 |
| 10 | Ga0466700_210494 | 3300042600 | Bacteria | 1181 |
| 11 | Ga0466713_110702 | 3300042602 | Unclassified | 2343 |
| 12 | Ga0466716_254389 | 3300042605 | Bacteria | 6264 |
| 13 | Ga0466720_095521 | 3300042607 | Bacteria | 18831 |
| 14 | Ga0466722_025586 | 3300042609 | Bacteria | 42977 |
| 15 | Ga0466694_180487 | 3300042594 | Bacteria | 1369 |
| 16 | Ga0466699_089262 | 3300042597 | Bacteria | 27561 |
| 17 | Ga0466699_195571 | 3300042597 | Bacteria | 31724 |
| 18 | JGI24698J34947_10028820 | 3300002449 | Bacteria | 2938 |
| 19 | JGI24695J34938_10035403 | 3300002450 | Bacteria | 2283 |
| 20 | Ga0466712_020733 | 3300042614 | Unclassified | 4153 |
| 21 | Ga0466712_045877 | 3300042614 | Bacteria | 18411 |
| 22 | Ga0466711_397594 | 3300042615 | Bacteria | 6017 |
| 23 | Ga0466718_082951 | 3300042617 | Bacteria | 1516 |
| 24 | Ga0466706_161522 | 3300042599 | Bacteria | 2352 |
| 25 | Ga0466722_015000 | 3300042609 | Bacteria | 11154 |
| 26 | Ga0466722_189876 | 3300042609 | Bacteria | 1599 |
| 27 | Ga0466732_030643 | 3300042656 | Bacteria | 6810 |
| 28 | Ga0222431_1020857 | 3300021190 | Bacteria | 1492 |
| 29 | Ga0466690_105510 | 3300042590 | Bacteria | 11354 |
| 30 | Ga0466692_015665 | 3300042591 | Bacteria | 2387 |
| 31 | Ga0466694_033448 | 3300042594 | Bacteria | 6723 |
| 32 | Ga0466699_365903 | 3300042597 | Bacteria | 5961 |
| 33 | JGI24698J34947_10031869 | 3300002449 | Bacteria | 2771 |
| 34 | JGI24698J34947_10053509 | 3300002449 | Unclassified | 2020 |
| 35 | JGI24695J34938_10016299 | 3300002450 | Bacteria | 3783 |
| 36 | Ga0068305_10085097 | 3300005083 | Bacteria | 1603 |
| 37 | Ga0466712_144120 | 3300042614 | Bacteria | 1389 |
| 38 | Ga0466712_217424 | 3300042614 | Bacteria | 2395 |
| 39 | Ga0466715_059256 | 3300042616 | Bacteria | 5815 |
| 40 | Ga0466715_198631 | 3300042616 | Bacteria | 7099 |
| 41 | Ga0466718_002573 | 3300042617 | Bacteria | 1142 |
| 42 | Ga0466718_072816 | 3300042617 | Bacteria | 2485 |
| 43 | Ga0466723_151504 | 3300042618 | Bacteria | 33081 |
| 44 | Ga0466720_056421 | 3300042607 | Bacteria | 1913 |
| 45 | Ga0466720_072577 | 3300042607 | Bacteria | 42009 |
| 46 | Ga0466720_075474 | 3300042607 | Bacteria | 1332 |
| 47 | JGI24698J34947_10011374 | 3300002449 | Bacteria | 4887 |
| 48 | JGI24698J34947_10076927 | 3300002449 | Bacteria | 1580 |
| 49 | JGI24695J34938_10006229 | 3300002450 | Bacteria | 7239 |
| 50 | JGI24695J34938_10021168 | 3300002450 | Bacteria | 3185 |
| 51 | Ga0072940_1022700 | 3300005200 | Bacteria | 11271 |
| 52 | Ga0466726_127231 | 3300042619 | Bacteria | 1408 |
| 53 | Ga0123356_10006621 | 3300010049 | Bacteria | 11675 |
| 54 | Ga0466700_010893 | 3300042600 | Bacteria | 1951 |
| 55 | Ga0466700_353240 | 3300042600 | Bacteria | 2109 |
| 56 | Ga0466707_287267 | 3300042601 | Bacteria | 1411 |
| 57 | Ga0466720_018934 | 3300042607 | Bacteria | 104216 |
| 58 | Ga0466720_062404 | 3300042607 | Bacteria | 24173 |
| 59 | Ga0466720_174843 | 3300042607 | Bacteria | 13899 |
| 60 | Ga0466720_201173 | 3300042607 | Bacteria | 1889 |
| 61 | Ga0264413_112801 | 3300024493 | Bacteria | 2793 |
| 62 | Ga0466699_020136 | 3300042597 | Bacteria | 2232 |
| 63 | JGI24698J34947_10002967 | 3300002449 | Bacteria | 9198 |
| 64 | JGI24698J34947_10030901 | 3300002449 | Unclassified | 2822 |
| 65 | Ga0466712_102538 | 3300042614 | Bacteria | 1079 |
| 66 | Ga0466712_124861 | 3300042614 | Bacteria | 3859 |
| 67 | Ga0466726_235974 | 3300042619 | Bacteria | 5692 |
| 68 | Ga0466708_372588 | 3300042652 | Bacteria | 3425 |
| 69 | Ga0123353_10093136 | 3300010167 | Bacteria | 4855 |
| 70 | Ga0466707_050001 | 3300042601 | Bacteria | 1445 |
| 71 | Ga0466720_110768 | 3300042607 | Bacteria | 5358 |
| 72 | Ga0466720_113824 | 3300042607 | Bacteria | 2178 |
| 73 | Ga0466720_130283 | 3300042607 | Bacteria | 4138 |
| 74 | Ga0466692_066064 | 3300042591 | Bacteria | 5159 |
| 75 | Ga0466693_368821 | 3300042592 | Bacteria | 3452 |
| 76 | Ga0466699_201606 | 3300042597 | Bacteria | 1319 |
| 77 | JGI24698J34947_10004930 | 3300002449 | Bacteria | 7314 |
| 78 | JGI24698J34947_10010127 | 3300002449 | Bacteria | 5166 |
| 79 | JGI24698J34947_10026780 | 3300002449 | Unclassified | 3062 |
| 80 | JGI24698J34947_10195570 | 3300002449 | Bacteria | 796 |
| 81 | Ga0466712_038130 | 3300042614 | Bacteria | 20446 |
| 82 | Ga0466712_050465 | 3300042614 | Bacteria | 3077 |
| 83 | Ga0466712_212052 | 3300042614 | Bacteria | 8939 |
| 84 | Ga0466711_300547 | 3300042615 | Bacteria | 1163 |
| 85 | Ga0466718_081342 | 3300042617 | Bacteria | 21401 |
| 86 | Ga0466700_242649 | 3300042600 | Bacteria | 1483 |
| 87 | Ga0466720_138224 | 3300042607 | Bacteria | 9857 |
| 88 | Ga0466699_188389 | 3300042597 | Bacteria | 16329 |
| 89 | Ga0466699_224549 | 3300042597 | Bacteria | 9714 |
| 90 | Ga0466699_338390 | 3300042597 | Bacteria | 5165 |
| 91 | JGI24695J34938_10011450 | 3300002450 | Bacteria | 4778 |
| 92 | JGI24695J34938_10146617 | 3300002450 | Bacteria | 966 |
| 93 | JGI24697J35500_11071282 | 3300002507 | Bacteria | 1086 |
| 94 | Ga0072941_1003983 | 3300005201 | Bacteria | 5741 |
| 95 | Ga0072941_1008410 | 3300005201 | Bacteria | 8969 |
| 96 | Ga0072941_1021430 | 3300005201 | Bacteria | 3874 |
| 97 | Ga0072941_1036590 | 3300005201 | Bacteria | 6185 |
| 98 | Ga0466712_055026 | 3300042614 | Archaea | 3235 |
| 99 | Ga0466712_152975 | 3300042614 | Bacteria | 8181 |
| 100 | Ga0466718_025634 | 3300042617 | Bacteria | 20527 |
| 101 | Ga0466718_131885 | 3300042617 | Bacteria | 15536 |
| 102 | Ga0466726_239229 | 3300042619 | Bacteria | 4573 |
| 103 | Ga0466727_192223 | 3300042655 | Bacteria | 3078 |
| 104 | Ga0466720_033010 | 3300042607 | Bacteria | 1046 |
| 105 | Ga0466720_135304 | 3300042607 | Bacteria | 3572 |
| 106 | Ga0466720_162482 | 3300042607 | Bacteria | 5182 |
| 107 | Ga0466698_440977 | 3300042610 | Bacteria | 1007 |
| 108 | Ga0264413_108314 | 3300024493 | Bacteria | 9513 |
| 109 | Ga0466694_063692 | 3300042594 | Bacteria | 5773 |
| 110 | Ga0466699_006774 | 3300042597 | Bacteria | 22044 |
| 111 | Ga0466699_027305 | 3300042597 | Bacteria | 21527 |
| 112 | Ga0466699_070553 | 3300042597 | Bacteria | 13941 |
| 113 | Ga0466699_271778 | 3300042597 | Bacteria | 2884 |
| 114 | Ga0466699_397013 | 3300042597 | Bacteria | 9856 |
| 115 | AustNasuHG_c1010069 | 3300000089 | Bacteria | 3304 |
| 116 | JGI24698J34947_10011171 | 3300002449 | Bacteria | 4929 |
| 117 | JGI24698J34947_10012604 | 3300002449 | Bacteria | 4631 |
| 118 | JGI24698J34947_10013218 | 3300002449 | Bacteria | 4511 |
| 119 | Ga0466712_253361 | 3300042614 | Bacteria | 30767 |
| 120 | Ga0466727_207211 | 3300042655 | Bacteria | 2841 |
| 121 | Ga0466720_017944 | 3300042607 | Bacteria | 63542 |
| 122 | Ga0466720_025958 | 3300042607 | Bacteria | 1383 |
| 123 | Ga0466720_083552 | 3300042607 | Bacteria | 10102 |
| 124 | Ga0466720_193509 | 3300042607 | Unclassified | 6740 |
| 125 | Ga0466722_014313 | 3300042609 | Bacteria | 18073 |
| 126 | Ga0466722_027106 | 3300042609 | Bacteria | 24794 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.