Protein Family IF07370
Metagenome
Isolate
122
Members
34
Samples
116
Scaffolds
263.18
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_107367|Ga0466712_107367_23_988
- Length
- 321 aa
- Sequence
- MSQFHDDPGKFLPFVFQIVQRGSDKNVVLHPFKYTEIQAKKQQEVMDDTRKVSYYKGMIGFLIRKTFYDLWDNMFRIVLLNLGFIVSLTIPIILPGYIPIPLLSIAVAAIGVFWCFIYLAAVALSLKAVSDYGVFGLADFKANLKAGWPAGVVMGLASFIFFLILRVIIPFYLDMNSLVGLLLGAVIFWTLILALVSFQFFFAIRARLDTKPIKIIKKCFIIFFDNPGFSIFSLLYTLATLVVSLIFALLLPGPAGLLLFLDEGLRLRLMKYDWLETVSQDNPPTAGPPRRRSIPWDALLIEEREKTGTRTFRNFIFPWKD
Sample Types
Isolate
4.9%
Metagenome
95.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.9%
Kalotermitidae
21.9%
Unclassified
18.8%
Rhinotermitidae
6.2%
Hodotermitidae
3.1%
Termopsidae
3.1%
Taxonomy
Archaea
0
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2819990093 | Unclassified Spirochaetes Cu122P1bin9 | Isolate | Unclassified |
| 2 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 3 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 6 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 7 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 8 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 12 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 16 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 17 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 18 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 19 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 20 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 21 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 25 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 26 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 27 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 2781125644 | Treponema sp. Co191P3bin12 | Isolate | Unclassified |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_051278 | 3300042599 | Bacteria | 5447 |
| 2 | JGI24698J34947_10008698 | 3300002449 | Bacteria | 5568 |
| 3 | JGI24698J34947_10011067 | 3300002449 | Bacteria | 4950 |
| 4 | Ga0466712_036167 | 3300042614 | Bacteria | 7811 |
| 5 | Ga0466712_177037 | 3300042614 | Bacteria | 13458 |
| 6 | Ga0415639_067572 | 3300038395 | Bacteria | 6125 |
| 7 | Ga0466692_158349 | 3300042591 | Bacteria | 8545 |
| 8 | Ga0466699_066186 | 3300042597 | Bacteria | 10023 |
| 9 | Ga0466699_119184 | 3300042597 | Bacteria | 1172 |
| 10 | Ga0466699_128402 | 3300042597 | Bacteria | 2537 |
| 11 | Ga0466699_170042 | 3300042597 | Unclassified | 3541 |
| 12 | Ga0466699_194310 | 3300042597 | Bacteria | 4382 |
| 13 | Ga0466698_406437 | 3300042610 | Bacteria | 1965 |
| 14 | Ga0466698_472613 | 3300042610 | Bacteria | 1374 |
| 15 | JGI24698J34947_10017559 | 3300002449 | Bacteria | 3876 |
| 16 | JGI24695J34938_10004315 | 3300002450 | Bacteria | 9368 |
| 17 | Ga0072941_1000636 | 3300005201 | Bacteria | 15567 |
| 18 | Ga0072941_1036046 | 3300005201 | Bacteria | 5327 |
| 19 | Ga0466712_076495 | 3300042614 | Bacteria | 3240 |
| 20 | Ga0466712_107367 | 3300042614 | Bacteria | 1067 |
| 21 | Ga0466718_018052 | 3300042617 | Bacteria | 14407 |
| 22 | Ga0264413_100823 | 3300024493 | Bacteria | 13465 |
| 23 | Ga0466692_185030 | 3300042591 | Bacteria | 1605 |
| 24 | Ga0466694_194136 | 3300042594 | Bacteria | 8525 |
| 25 | Ga0466732_068350 | 3300042656 | Bacteria | 9443 |
| 26 | Ga0466720_071556 | 3300042607 | Bacteria | 10684 |
| 27 | JGI24698J34947_10045442 | 3300002449 | Bacteria | 2241 |
| 28 | JGI24695J34938_10000631 | 3300002450 | Bacteria | 33552 |
| 29 | Ga0466704_450996 | 3300042643 | Bacteria | 30662 |
| 30 | Ga0466712_050157 | 3300042614 | Bacteria | 1963 |
| 31 | Ga0466712_123419 | 3300042614 | Bacteria | 7915 |
| 32 | Ga0466694_232366 | 3300042594 | Bacteria | 2637 |
| 33 | Ga0466716_039686 | 3300042605 | Bacteria | 5099 |
| 34 | Ga0466722_080852 | 3300042609 | Bacteria | 4461 |
| 35 | Ga0466698_200599 | 3300042610 | Bacteria | 3122 |
| 36 | Ga0123353_10023541 | 3300010167 | Bacteria | 9328 |
| 37 | JGI24698J34947_10021981 | 3300002449 | Bacteria | 3425 |
| 38 | JGI24698J34947_10024205 | 3300002449 | Bacteria | 3243 |
| 39 | JGI24698J34947_10033698 | 3300002449 | Bacteria | 2684 |
| 40 | JGI24698J34947_10040215 | 3300002449 | Bacteria | 2416 |
| 41 | JGI24698J34947_10067834 | 3300002449 | Bacteria | 1728 |
| 42 | Ga0072941_1020126 | 3300005201 | Bacteria | 7605 |
| 43 | Ga0072941_1132511 | 3300005201 | Bacteria | 3266 |
| 44 | Ga0466703_115999 | 3300042636 | Bacteria | 10851 |
| 45 | Ga0466703_404262 | 3300042636 | Bacteria | 2715 |
| 46 | Ga0466712_152695 | 3300042614 | Bacteria | 3324 |
| 47 | Ga0466712_267773 | 3300042614 | Bacteria | 21070 |
| 48 | Ga0466723_149854 | 3300042618 | Bacteria | 25559 |
| 49 | Ga0466726_376447 | 3300042619 | Bacteria | 2311 |
| 50 | Ga0264413_100902 | 3300024493 | Bacteria | 9959 |
| 51 | Ga0466690_001515 | 3300042590 | Bacteria | 6015 |
| 52 | Ga0466694_167475 | 3300042594 | Bacteria | 1305 |
| 53 | Ga0466699_002237 | 3300042597 | Bacteria | 1366 |
| 54 | Ga0466699_247444 | 3300042597 | Bacteria | 1026 |
| 55 | Ga0466699_350745 | 3300042597 | Bacteria | 3284 |
| 56 | Ga0466719_022775 | 3300042606 | Unclassified | 3743 |
| 57 | Ga0123356_10000767 | 3300010049 | Bacteria | 35460 |
| 58 | Ga0123356_10290631 | 3300010049 | Bacteria | 1735 |
| 59 | JGI24698J34947_10006874 | 3300002449 | Bacteria | 6252 |
| 60 | JGI24698J34947_10008788 | 3300002449 | Bacteria | 5540 |
| 61 | JGI24698J34947_10048638 | 3300002449 | Bacteria | 2146 |
| 62 | JGI24695J34938_10002059 | 3300002450 | Bacteria | 15814 |
| 63 | JGI24695J34938_10007887 | 3300002450 | Bacteria | 6159 |
| 64 | Ga0072941_1041944 | 3300005201 | Bacteria | 7016 |
| 65 | Ga0466712_227295 | 3300042614 | Bacteria | 3692 |
| 66 | Ga0466718_022003 | 3300042617 | Bacteria | 1453 |
| 67 | Ga0466691_021978 | 3300042593 | Unclassified | 3898 |
| 68 | Ga0466694_286262 | 3300042594 | Bacteria | 1056 |
| 69 | Ga0466699_124485 | 3300042597 | Bacteria | 3863 |
| 70 | Ga0466699_171801 | 3300042597 | Bacteria | 13472 |
| 71 | Ga0466699_195529 | 3300042597 | Bacteria | 8358 |
| 72 | Ga0466733_181624 | 3300042659 | Bacteria | 1569 |
| 73 | Ga0123356_11083984 | 3300010049 | Bacteria | 970 |
| 74 | JGI24698J34947_10130385 | 3300002449 | Bacteria | 1075 |
| 75 | JGI24695J34938_10086926 | 3300002450 | Bacteria | 1286 |
| 76 | Ga0466703_235569 | 3300042636 | Bacteria | 46354 |
| 77 | Ga0466712_257815 | 3300042614 | Bacteria | 3545 |
| 78 | Ga0466712_300761 | 3300042614 | Unclassified | 2086 |
| 79 | Ga0264413_100901 | 3300024493 | Bacteria | 9484 |
| 80 | Ga0466699_261022 | 3300042597 | Bacteria | 2852 |
| 81 | Ga0466732_283217 | 3300042656 | Bacteria | 1234 |
| 82 | Ga0466720_174806 | 3300042607 | Bacteria | 5581 |
| 83 | Ga0466722_116166 | 3300042609 | Bacteria | 1711 |
| 84 | JGI24698J34947_10002227 | 3300002449 | Bacteria | 10387 |
| 85 | JGI24698J34947_10006439 | 3300002449 | Bacteria | 6445 |
| 86 | JGI24698J34947_10008769 | 3300002449 | Bacteria | 5545 |
| 87 | JGI24698J34947_10012931 | 3300002449 | Bacteria | 4561 |
| 88 | JGI24698J34947_10013655 | 3300002449 | Bacteria | 4427 |
| 89 | JGI24698J34947_10034545 | 3300002449 | Bacteria | 2645 |
| 90 | JGI24695J34938_10004008 | 3300002450 | Bacteria | 9911 |
| 91 | JGI24695J34938_10007162 | 3300002450 | Bacteria | 6584 |
| 92 | Ga0466702_115944 | 3300042635 | Bacteria | 1439 |
| 93 | Ga0466704_018726 | 3300042643 | Bacteria | 1440 |
| 94 | Ga0466712_186347 | 3300042614 | Bacteria | 7417 |
| 95 | Ga0466712_198456 | 3300042614 | Bacteria | 11385 |
| 96 | Ga0466712_296815 | 3300042614 | Bacteria | 1738 |
| 97 | Ga0466690_355312 | 3300042590 | Bacteria | 7657 |
| 98 | Ga0466694_388893 | 3300042594 | Unclassified | 6678 |
| 99 | Ga0466699_068649 | 3300042597 | Bacteria | 5893 |
| 100 | Ga0466699_176225 | 3300042597 | Bacteria | 16865 |
| 101 | Ga0466720_090987 | 3300042607 | Bacteria | 2494 |
| 102 | Ga0466720_092177 | 3300042607 | Bacteria | 42147 |
| 103 | Ga0466720_222968 | 3300042607 | Bacteria | 1502 |
| 104 | Ga0466722_256973 | 3300042609 | Bacteria | 13522 |
| 105 | Ga0466698_164009 | 3300042610 | Bacteria | 3717 |
| 106 | Ga0123356_10316729 | 3300010049 | Bacteria | 1671 |
| 107 | JGI24698J34947_10027707 | 3300002449 | Bacteria | 3005 |
| 108 | JGI24698J34947_10087724 | 3300002449 | Bacteria | 1438 |
| 109 | JGI24695J34938_10089251 | 3300002450 | Bacteria | 1266 |
| 110 | JGI24699J35502_11089180 | 3300002509 | Unclassified | 2104 |
| 111 | Ga0072941_1010098 | 3300005201 | Bacteria | 12642 |
| 112 | Ga0466704_035661 | 3300042643 | Bacteria | 27042 |
| 113 | Ga0466712_256048 | 3300042614 | Bacteria | 11462 |
| 114 | Ga0466691_104861 | 3300042593 | Bacteria | 10770 |
| 115 | Ga0466694_051126 | 3300042594 | Bacteria | 14193 |
| 116 | Ga0466699_430776 | 3300042597 | Bacteria | 1879 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.