Protein Family IF07361
Metagenome
Isolate
186
Members
47
Samples
179
Scaffolds
302.31
Avg Length
Representative Sequence
- ID
- 3300042614|Ga0466712_082108|Ga0466712_082108_4059_5063
- Length
- 334 aa
- Sequence
- LNADFHIFPLPNYNTVQAGMTRTVFSVILEIMNVKDSVYSESSWLAFLKSVFVPSLRKAFCKCVPSIFFNFFLRQYHAAFLPGRVPVSKVDHPLDEKIPFVPAWVTIYLDFVNFWIRMLSFFFRRYGRRVYAQSGAFIQSMGELYAFASEVYRKNFSTTNRPFYIARPRFFLIHLLDPHLMCIPSLHVMVAIHAYTQFEAIAKSLGEEEILKEQAFEMRQGALAISQAILFVKQHSVNCIPAALYAMTCFSPELFPPEEAEAFTQRLFSPAPDKANMPPGCRVHPAASPSTKLPAADTAEIKSHILTLYRRFLEEGEPCEFWGEPLVNFLRKLN
Sample Types
Isolate
3.8%
Metagenome
96.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
44.4%
Kalotermitidae
26.7%
Unclassified
15.6%
Rhinotermitidae
8.9%
Termopsidae
4.4%
Taxonomy
Archaea
1
Bacteria
173
Eukaryota
0
Viruses
0
Unclassified
12
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 9 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 10 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 11 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 12 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 13 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 14 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 15 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 16 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 17 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 18 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 21 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 22 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 23 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 24 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 25 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 26 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 34 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 38 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 41 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 42 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 43 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 44 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 45 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 46 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 47 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10016857 | 3300010049 | Bacteria | 6963 |
| 2 | Ga0123356_10033598 | 3300010049 | Bacteria | 4796 |
| 3 | Ga0123356_10043925 | 3300010049 | Bacteria | 4161 |
| 4 | Ga0123356_10202263 | 3300010049 | Bacteria | 2027 |
| 5 | AustNasuHG_c1016876 | 3300000089 | Bacteria | 2436 |
| 6 | JGI24698J34947_10003898 | 3300002449 | Bacteria | 8114 |
| 7 | JGI24698J34947_10034433 | 3300002449 | Bacteria | 2650 |
| 8 | JGI24698J34947_10039113 | 3300002449 | Bacteria | 2457 |
| 9 | JGI24695J34938_10000043 | 3300002450 | Bacteria | 94696 |
| 10 | JGI24695J34938_10119211 | 3300002450 | Bacteria | 1074 |
| 11 | Ga0072941_1013384 | 3300005201 | Bacteria | 7274 |
| 12 | Ga0466712_063864 | 3300042614 | Bacteria | 20972 |
| 13 | Ga0466718_044459 | 3300042617 | Bacteria | 6615 |
| 14 | Ga0466718_070415 | 3300042617 | Bacteria | 1761 |
| 15 | Ga0466731_080007 | 3300042622 | Bacteria | 2145 |
| 16 | Ga0466692_047928 | 3300042591 | Bacteria | 29037 |
| 17 | Ga0466694_010564 | 3300042594 | Unclassified | 1674 |
| 18 | Ga0466694_135255 | 3300042594 | Bacteria | 3011 |
| 19 | Ga0466699_350226 | 3300042597 | Bacteria | 1211 |
| 20 | Ga0466698_335199 | 3300042610 | Bacteria | 1429 |
| 21 | Ga0466705_075889 | 3300042612 | Bacteria | 3012 |
| 22 | Ga0466732_100666 | 3300042656 | Bacteria | 2231 |
| 23 | Ga0123356_10030901 | 3300010049 | Bacteria | 5011 |
| 24 | Ga0123356_10202028 | 3300010049 | Bacteria | 2028 |
| 25 | Ga0123356_10454776 | 3300010049 | Bacteria | 1429 |
| 26 | JGI24698J34947_10014601 | 3300002449 | Bacteria | 4278 |
| 27 | JGI24698J34947_10046581 | 3300002449 | Unclassified | 2205 |
| 28 | JGI24695J34938_10009100 | 3300002450 | Bacteria | 5561 |
| 29 | Ga0072941_1002712 | 3300005201 | Bacteria | 4091 |
| 30 | Ga0072941_1034401 | 3300005201 | Bacteria | 9527 |
| 31 | Ga0466712_010743 | 3300042614 | Bacteria | 1017 |
| 32 | Ga0466712_014001 | 3300042614 | Bacteria | 8844 |
| 33 | Ga0466712_060701 | 3300042614 | Unclassified | 2454 |
| 34 | Ga0264413_117433 | 3300024493 | Bacteria | 1333 |
| 35 | Ga0415639_024959 | 3300038395 | Bacteria | 1614 |
| 36 | Ga0415639_033398 | 3300038395 | Bacteria | 11517 |
| 37 | Ga0466690_359493 | 3300042590 | Bacteria | 1172 |
| 38 | Ga0466691_144572 | 3300042593 | Bacteria | 4174 |
| 39 | Ga0466694_235863 | 3300042594 | Bacteria | 1438 |
| 40 | Ga0466699_273821 | 3300042597 | Bacteria | 24467 |
| 41 | Ga0466719_129876 | 3300042606 | Archaea | 3598 |
| 42 | Ga0466720_037699 | 3300042607 | Bacteria | 6581 |
| 43 | Ga0466722_019023 | 3300042609 | Bacteria | 8953 |
| 44 | Ga0123356_10000380 | 3300010049 | Bacteria | 50618 |
| 45 | JGI24698J34947_10012050 | 3300002449 | Bacteria | 4746 |
| 46 | JGI24698J34947_10022978 | 3300002449 | Bacteria | 3338 |
| 47 | JGI24698J34947_10045181 | 3300002449 | Unclassified | 2250 |
| 48 | JGI24695J34938_10001940 | 3300002450 | Bacteria | 16621 |
| 49 | JGI24695J34938_10004175 | 3300002450 | Bacteria | 9613 |
| 50 | JGI24695J34938_10029839 | 3300002450 | Bacteria | 2545 |
| 51 | JGI24695J34938_10064111 | 3300002450 | Bacteria | 1555 |
| 52 | Ga0466712_085113 | 3300042614 | Bacteria | 12176 |
| 53 | Ga0466715_106458 | 3300042616 | Bacteria | 2845 |
| 54 | Ga0466723_032563 | 3300042618 | Bacteria | 12635 |
| 55 | Ga0466702_179902 | 3300042635 | Bacteria | 71441 |
| 56 | Ga0466693_353577 | 3300042592 | Bacteria | 1692 |
| 57 | Ga0466691_052723 | 3300042593 | Bacteria | 6402 |
| 58 | Ga0466694_130013 | 3300042594 | Bacteria | 2169 |
| 59 | Ga0466699_219097 | 3300042597 | Bacteria | 1641 |
| 60 | Ga0466699_295224 | 3300042597 | Bacteria | 14317 |
| 61 | Ga0466722_079405 | 3300042609 | Bacteria | 6823 |
| 62 | Ga0466722_134489 | 3300042609 | Bacteria | 4584 |
| 63 | Ga0123356_10000124 | 3300010049 | Bacteria | 85126 |
| 64 | Ga0123356_10010477 | 3300010049 | Bacteria | 9098 |
| 65 | Ga0123356_10017348 | 3300010049 | Bacteria | 6849 |
| 66 | JGI24698J34947_10013843 | 3300002449 | Bacteria | 4397 |
| 67 | JGI24698J34947_10027770 | 3300002449 | Bacteria | 3001 |
| 68 | JGI24695J34938_10001077 | 3300002450 | Bacteria | 24647 |
| 69 | Ga0072941_1015841 | 3300005201 | Bacteria | 14795 |
| 70 | Ga0072941_1021716 | 3300005201 | Bacteria | 3954 |
| 71 | Ga0466712_072500 | 3300042614 | Unclassified | 1805 |
| 72 | Ga0466712_089818 | 3300042614 | Bacteria | 20855 |
| 73 | Ga0466712_109362 | 3300042614 | Bacteria | 7781 |
| 74 | Ga0466718_018389 | 3300042617 | Bacteria | 4466 |
| 75 | Ga0466718_030128 | 3300042617 | Bacteria | 1129 |
| 76 | Ga0466718_062084 | 3300042617 | Bacteria | 5812 |
| 77 | Ga0466723_213604 | 3300042618 | Bacteria | 1095 |
| 78 | Ga0466728_436458 | 3300042620 | Bacteria | 5173 |
| 79 | Ga0466731_133111 | 3300042622 | Bacteria | 5187 |
| 80 | Ga0466704_285386 | 3300042643 | Bacteria | 59541 |
| 81 | Ga0415639_101310 | 3300038395 | Bacteria | 12566 |
| 82 | Ga0466695_209224 | 3300042595 | Bacteria | 10837 |
| 83 | Ga0123356_10048934 | 3300010049 | Bacteria | 3934 |
| 84 | Ga0123356_10494301 | 3300010049 | Bacteria | 1378 |
| 85 | JGI24695J34938_10000176 | 3300002450 | Bacteria | 59497 |
| 86 | JGI24695J34938_10019260 | 3300002450 | Bacteria | 3389 |
| 87 | JGI24695J34938_10032918 | 3300002450 | Bacteria | 2390 |
| 88 | JGI24699J35502_11106730 | 3300002509 | Bacteria | 2535 |
| 89 | Ga0072941_1009583 | 3300005201 | Bacteria | 11894 |
| 90 | Ga0072941_1020972 | 3300005201 | Bacteria | 14426 |
| 91 | Ga0072941_1021733 | 3300005201 | Bacteria | 5593 |
| 92 | Ga0466712_002956 | 3300042614 | Bacteria | 9329 |
| 93 | Ga0466712_029054 | 3300042614 | Bacteria | 4654 |
| 94 | Ga0466712_043197 | 3300042614 | Bacteria | 7077 |
| 95 | Ga0466712_082108 | 3300042614 | Bacteria | 22220 |
| 96 | Ga0466712_112359 | 3300042614 | Bacteria | 8082 |
| 97 | Ga0466711_134824 | 3300042615 | Unclassified | 7281 |
| 98 | Ga0466726_010595 | 3300042619 | Bacteria | 2057 |
| 99 | Ga0466702_321028 | 3300042635 | Bacteria | 4532 |
| 100 | Ga0415639_021963 | 3300038395 | Bacteria | 8455 |
| 101 | Ga0415639_248831 | 3300038395 | Bacteria | 1757 |
| 102 | Ga0466693_011947 | 3300042592 | Bacteria | 23821 |
| 103 | Ga0466693_186633 | 3300042592 | Bacteria | 79738 |
| 104 | Ga0466699_015973 | 3300042597 | Bacteria | 123791 |
| 105 | Ga0466699_150579 | 3300042597 | Bacteria | 1450 |
| 106 | Ga0466699_345223 | 3300042597 | Bacteria | 4909 |
| 107 | Ga0466699_414250 | 3300042597 | Bacteria | 2475 |
| 108 | Ga0466699_428562 | 3300042597 | Bacteria | 4912 |
| 109 | Ga0466699_432919 | 3300042597 | Bacteria | 10894 |
| 110 | Ga0123356_10012688 | 3300010049 | Bacteria | 8167 |
| 111 | Ga0123356_10623413 | 3300010049 | Bacteria | 1244 |
| 112 | JGI24698J34947_10003176 | 3300002449 | Bacteria | 8900 |
| 113 | JGI24698J34947_10005556 | 3300002449 | Bacteria | 6916 |
| 114 | JGI24695J34938_10003037 | 3300002450 | Bacteria | 12040 |
| 115 | JGI24695J34938_10006370 | 3300002450 | Unclassified | 7116 |
| 116 | JGI24695J34938_10014469 | 3300002450 | Bacteria | 4088 |
| 117 | JGI24700J35501_10930300 | 3300002508 | Bacteria | 12856 |
| 118 | Ga0072941_1038594 | 3300005201 | Bacteria | 5808 |
| 119 | Ga0466712_058559 | 3300042614 | Bacteria | 28216 |
| 120 | Ga0466712_065021 | 3300042614 | Bacteria | 4864 |
| 121 | Ga0466712_153987 | 3300042614 | Bacteria | 26468 |
| 122 | Ga0466715_321866 | 3300042616 | Bacteria | 9130 |
| 123 | Ga0466718_031036 | 3300042617 | Bacteria | 4703 |
| 124 | Ga0466728_023856 | 3300042620 | Bacteria | 4623 |
| 125 | Ga0466729_269459 | 3300042621 | Bacteria | 2371 |
| 126 | Ga0466731_012364 | 3300042622 | Bacteria | 28543 |
| 127 | Ga0466731_131043 | 3300042622 | Bacteria | 1123 |
| 128 | Ga0466709_034987 | 3300042648 | Bacteria | 3260 |
| 129 | Ga0466727_335446 | 3300042655 | Bacteria | 1898 |
| 130 | Ga0466694_334760 | 3300042594 | Bacteria | 1171 |
| 131 | Ga0466699_070200 | 3300042597 | Bacteria | 11646 |
| 132 | Ga0466719_113796 | 3300042606 | Bacteria | 7802 |
| 133 | Ga0466720_118362 | 3300042607 | Bacteria | 35686 |
| 134 | Ga0466722_016318 | 3300042609 | Bacteria | 3704 |
| 135 | Ga0466698_063550 | 3300042610 | Bacteria | 2987 |
| 136 | JGI24698J34947_10001782 | 3300002449 | Bacteria | 11479 |
| 137 | JGI24698J34947_10010842 | 3300002449 | Unclassified | 5000 |
| 138 | JGI24698J34947_10015162 | 3300002449 | Unclassified | 4198 |
| 139 | JGI24695J34938_10000078 | 3300002450 | Bacteria | 82675 |
| 140 | JGI24695J34938_10000883 | 3300002450 | Bacteria | 27695 |
| 141 | JGI24695J34938_10008888 | 3300002450 | Bacteria | 5671 |
| 142 | JGI24695J34938_10019012 | 3300002450 | Bacteria | 3416 |
| 143 | Ga0072941_1020708 | 3300005201 | Bacteria | 6143 |
| 144 | Ga0072941_1099584 | 3300005201 | Bacteria | 1626 |
| 145 | Ga0466712_001744 | 3300042614 | Bacteria | 5180 |
| 146 | Ga0466712_044392 | 3300042614 | Bacteria | 2476 |
| 147 | Ga0466712_081395 | 3300042614 | Bacteria | 5249 |
| 148 | Ga0466712_228312 | 3300042614 | Bacteria | 11861 |
| 149 | Ga0466692_117326 | 3300042591 | Bacteria | 4477 |
| 150 | Ga0466693_302537 | 3300042592 | Bacteria | 6285 |
| 151 | Ga0466694_127627 | 3300042594 | Bacteria | 23150 |
| 152 | Ga0466717_087856 | 3300042604 | Unclassified | 2806 |
| 153 | Ga0466722_176287 | 3300042609 | Bacteria | 4136 |
| 154 | Ga0466732_082723 | 3300042656 | Bacteria | 5254 |
| 155 | Ga0123356_10000078 | 3300010049 | Bacteria | 103379 |
| 156 | Ga0123356_10582479 | 3300010049 | Bacteria | 1282 |
| 157 | AustNasuHG_c1023372 | 3300000089 | Bacteria | 1974 |
| 158 | AustNasuHG_c1025771 | 3300000089 | Bacteria | 1842 |
| 159 | JGI24698J34947_10016105 | 3300002449 | Unclassified | 4062 |
| 160 | JGI24698J34947_10098902 | 3300002449 | Bacteria | 1317 |
| 161 | JGI24695J34938_10002224 | 3300002450 | Bacteria | 15077 |
| 162 | JGI24699J35502_11095605 | 3300002509 | Bacteria | 2229 |
| 163 | JGI24696J40584_12951739 | 3300002834 | Unclassified | 2273 |
| 164 | Ga0072941_1068550 | 3300005201 | Bacteria | 1978 |
| 165 | Ga0466712_056070 | 3300042614 | Bacteria | 8391 |
| 166 | Ga0466712_200360 | 3300042614 | Bacteria | 13582 |
| 167 | Ga0466711_155095 | 3300042615 | Bacteria | 2807 |
| 168 | Ga0466708_051218 | 3300042652 | Bacteria | 2060 |
| 169 | Ga0466727_142222 | 3300042655 | Bacteria | 6346 |
| 170 | Ga0456237_0014282 | 3300041968 | Bacteria | 1132 |
| 171 | Ga0466692_067795 | 3300042591 | Bacteria | 3741 |
| 172 | Ga0466692_072711 | 3300042591 | Bacteria | 2540 |
| 173 | Ga0466692_177400 | 3300042591 | Bacteria | 2247 |
| 174 | Ga0466694_074466 | 3300042594 | Bacteria | 22282 |
| 175 | Ga0466694_379709 | 3300042594 | Bacteria | 72022 |
| 176 | Ga0466699_137643 | 3300042597 | Bacteria | 2162 |
| 177 | Ga0466699_301575 | 3300042597 | Bacteria | 8866 |
| 178 | Ga0466716_196871 | 3300042605 | Bacteria | 3177 |
| 179 | Ga0466722_111930 | 3300042609 | Bacteria | 16207 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.