Protein Family IF07318
Metagenome
Isolate
165
Members
67
Samples
142
Scaffolds
186.45
Avg Length
Representative Sequence
- ID
- 3300042613|Ga0466710_373677|Ga0466710_373677_1012_1668
- Length
- 185 aa
- Sequence
- LQSKQTIAFISPISAQVTKIFTIFASRISKSKKMDTTTIKKDAEEKMSMTLEFLEETFSRIRAGRANAKILDGVRVDYYGTMSPLSSVATVSVPDAKTIMIQPWMDSDVGITPENNGEVIRLGIPPLTEERRKQLVKQTKQEAEDAKVSIRMGKDLEAELQKIHDKYIKKVDELFALKEKEILTV
Sample Types
Isolate
13.9%
Metagenome
86.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
29.9%
Blattidae
28.4%
Kalotermitidae
19.4%
Unclassified
10.4%
Rhinotermitidae
4.5%
Termopsidae
4.5%
Passalidae
3.0%
Taxonomy
Archaea
0
Bacteria
161
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 2 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 3 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 4 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 7 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 8 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 9 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 10 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 11 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 12 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 13 | 2940199050 | Parabacteroides sp. PM6-13 | Isolate | Blattidae |
| 14 | 2940202316 | Parabacteroides sp. PF5-9 | Isolate | Blattidae |
| 15 | 2940371297 | Parabacteroides sp. PM5-20 | Isolate | Blattidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 21 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 26 | 2940209341 | Parabacteroides sp. PFB2-10 | Isolate | Blattidae |
| 27 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 28 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 29 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 30 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 31 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 32 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 33 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 34 | 2940346213 | Parabacteroides sp. PFB2-12 | Isolate | Blattidae |
| 35 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 36 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 37 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 38 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 39 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 40 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 41 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 42 | 3300042613 | Termite gut microbial communities of Jugositermes tuberculatus from Ebogo II, Mbalmayo, Cameroon - Jx357 | Metagenome | Termitidae |
| 43 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 44 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 45 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 46 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 47 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 48 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 49 | 2820778767 | Unclassified Bacteroidetes Emb289P4bin10 | Isolate | Unclassified |
| 50 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 51 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 52 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 53 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 54 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 55 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 56 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 57 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 58 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 59 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 60 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 61 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 62 | 2820762746 | Unclassified Bacteroidetes Mp193P4bin3 | Isolate | Unclassified |
| 63 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 64 | 2940216256 | Dysgonomonadaceae bacterium PH5-43 | Isolate | Blattidae |
| 65 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 66 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 67 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466710_443272 | 3300042613 | Bacteria | 1059 |
| 2 | Ga0466715_052608 | 3300042616 | Bacteria | 1711 |
| 3 | Ga0466723_250630 | 3300042618 | Bacteria | 3025 |
| 4 | Ga0466713_039709 | 3300042602 | Bacteria | 19483 |
| 5 | Ga0466713_044168 | 3300042602 | Bacteria | 23186 |
| 6 | Ga0466713_143596 | 3300042602 | Bacteria | 1025 |
| 7 | Ga0466719_372237 | 3300042606 | Bacteria | 8104 |
| 8 | Ga0466719_379862 | 3300042606 | Bacteria | 2643 |
| 9 | Ga0466722_165113 | 3300042609 | Bacteria | 35000 |
| 10 | Ga0123357_10048971 | 3300009784 | Bacteria | 5724 |
| 11 | Ga0123354_10001542 | 3300010882 | Bacteria | 28227 |
| 12 | Ga0466703_091416 | 3300042636 | Bacteria | 2061 |
| 13 | Ga0466704_404355 | 3300042643 | Bacteria | 3624 |
| 14 | Ga0466704_434670 | 3300042643 | Bacteria | 2827 |
| 15 | Ga0068305_10094748 | 3300005083 | Unclassified | 2064 |
| 16 | Ga0466732_439102 | 3300042656 | Bacteria | 1749 |
| 17 | Ga0466692_163838 | 3300042591 | Bacteria | 4088 |
| 18 | Ga0466696_402975 | 3300042596 | Bacteria | 9226 |
| 19 | Ga0466715_076359 | 3300042616 | Bacteria | 15631 |
| 20 | Ga0466707_093234 | 3300042601 | Bacteria | 3556 |
| 21 | Ga0466713_117834 | 3300042602 | Bacteria | 19690 |
| 22 | 2227507408 | 2225789004 | Bacteria | 3639 |
| 23 | JGI24702J35022_10002945 | 3300002462 | Bacteria | 10301 |
| 24 | Ga0466705_035757 | 3300042612 | Bacteria | 2706 |
| 25 | Ga0466705_305717 | 3300042612 | Bacteria | 3837 |
| 26 | Ga0466693_231727 | 3300042592 | Bacteria | 1231 |
| 27 | Ga0466696_215072 | 3300042596 | Bacteria | 4375 |
| 28 | Ga0466696_241696 | 3300042596 | Bacteria | 4672 |
| 29 | Ga0466701_008972 | 3300042598 | Bacteria | 1685 |
| 30 | Ga0466711_069341 | 3300042615 | Bacteria | 69315 |
| 31 | Ga0466726_170632 | 3300042619 | Bacteria | 1284 |
| 32 | Ga0466707_234788 | 3300042601 | Bacteria | 3141 |
| 33 | Ga0466713_074241 | 3300042602 | Bacteria | 3771 |
| 34 | Ga0466716_302468 | 3300042605 | Bacteria | 23384 |
| 35 | Ga0123357_10384078 | 3300009784 | Bacteria | 1299 |
| 36 | Ga0123356_10005302 | 3300010049 | Bacteria | 13145 |
| 37 | Ga0466734_118126 | 3300042623 | Bacteria | 1509 |
| 38 | Ga0466735_026195 | 3300042624 | Bacteria | 1129 |
| 39 | Ga0466735_041735 | 3300042624 | Bacteria | 2361 |
| 40 | Ga0466735_089440 | 3300042624 | Bacteria | 2112 |
| 41 | Ga0466735_130472 | 3300042624 | Bacteria | 2643 |
| 42 | Ga0466725_459619 | 3300042654 | Bacteria | 1341 |
| 43 | Ga0466727_042345 | 3300042655 | Bacteria | 13374 |
| 44 | IMNBL1DRAFT_c0082808 | 3300000062 | Bacteria | 896 |
| 45 | Ga0466657_159134 | 3300042582 | Bacteria | 10484 |
| 46 | Ga0466690_145185 | 3300042590 | Bacteria | 12761 |
| 47 | Ga0466690_218433 | 3300042590 | Bacteria | 3017 |
| 48 | Ga0466690_340718 | 3300042590 | Bacteria | 6390 |
| 49 | Ga0466694_235763 | 3300042594 | Bacteria | 1459 |
| 50 | Ga0466696_214177 | 3300042596 | Bacteria | 1759 |
| 51 | Ga0466696_345175 | 3300042596 | Bacteria | 10393 |
| 52 | Ga0466715_231121 | 3300042616 | Bacteria | 27941 |
| 53 | Ga0466726_266114 | 3300042619 | Bacteria | 14251 |
| 54 | Ga0466726_323051 | 3300042619 | Bacteria | 2652 |
| 55 | Ga0466728_021948 | 3300042620 | Bacteria | 3982 |
| 56 | Ga0466707_177566 | 3300042601 | Bacteria | 11010 |
| 57 | Ga0466722_150021 | 3300042609 | Bacteria | 11279 |
| 58 | Ga0466735_098167 | 3300042624 | Bacteria | 1805 |
| 59 | Ga0466735_114191 | 3300042624 | Bacteria | 1585 |
| 60 | Ga0466735_136106 | 3300042624 | Bacteria | 20578 |
| 61 | Ga0466704_073513 | 3300042643 | Bacteria | 6622 |
| 62 | 2227414120 | 2225789004 | Bacteria | 26663 |
| 63 | IMNBL1DRAFT_c0000967 | 3300000062 | Bacteria | 22204 |
| 64 | JGI24702J35022_10004410 | 3300002462 | Bacteria | 8359 |
| 65 | JGI24702J35022_10452510 | 3300002462 | Bacteria | 782 |
| 66 | Ga0123357_10001231 | 3300009784 | Bacteria | 26869 |
| 67 | Ga0415639_258350 | 3300038395 | Bacteria | 1013 |
| 68 | Ga0466710_373677 | 3300042613 | Bacteria | 21386 |
| 69 | Ga0466711_490041 | 3300042615 | Bacteria | 3963 |
| 70 | Ga0466723_265163 | 3300042618 | Bacteria | 1408 |
| 71 | Ga0466707_208886 | 3300042601 | Bacteria | 2963 |
| 72 | Ga0466716_177205 | 3300042605 | Bacteria | 3277 |
| 73 | Ga0466722_081713 | 3300042609 | Bacteria | 4561 |
| 74 | Ga0123357_10008613 | 3300009784 | Bacteria | 12765 |
| 75 | Ga0123357_10030231 | 3300009784 | Bacteria | 7343 |
| 76 | Ga0123353_10100763 | 3300010167 | Bacteria | 4656 |
| 77 | Ga0123353_10121192 | 3300010167 | Bacteria | 4206 |
| 78 | Ga0123353_10944190 | 3300010167 | Bacteria | 1167 |
| 79 | Ga0123354_10039470 | 3300010882 | Bacteria | 7317 |
| 80 | Ga0123354_10136403 | 3300010882 | Unclassified | 3065 |
| 81 | Ga0466729_239996 | 3300042621 | Bacteria | 15530 |
| 82 | Ga0466735_176466 | 3300042624 | Bacteria | 3485 |
| 83 | Ga0466704_197215 | 3300042643 | Bacteria | 2408 |
| 84 | Ga0466727_124126 | 3300042655 | Bacteria | 7801 |
| 85 | JGI24705J35276_12075112 | 3300002504 | Bacteria | 962 |
| 86 | JGI24699J35502_11127536 | 3300002509 | Bacteria | 4176 |
| 87 | JGI24699J35502_11134011 | 3300002509 | Bacteria | 24103 |
| 88 | Ga0466690_404209 | 3300042590 | Bacteria | 3172 |
| 89 | Ga0466692_181143 | 3300042591 | Bacteria | 18569 |
| 90 | Ga0466691_195452 | 3300042593 | Bacteria | 11459 |
| 91 | Ga0466694_398916 | 3300042594 | Bacteria | 1655 |
| 92 | Ga0466712_045488 | 3300042614 | Bacteria | 2181 |
| 93 | Ga0466715_222839 | 3300042616 | Bacteria | 6079 |
| 94 | Ga0466715_289675 | 3300042616 | Bacteria | 35409 |
| 95 | Ga0466700_036651 | 3300042600 | Bacteria | 2758 |
| 96 | Ga0466707_111695 | 3300042601 | Bacteria | 37145 |
| 97 | Ga0466707_305705 | 3300042601 | Bacteria | 37461 |
| 98 | Ga0466713_027887 | 3300042602 | Bacteria | 2533 |
| 99 | Ga0466722_126170 | 3300042609 | Bacteria | 47921 |
| 100 | Ga0466722_136436 | 3300042609 | Bacteria | 9717 |
| 101 | Ga0123357_10428153 | 3300009784 | Bacteria | 1172 |
| 102 | Ga0123354_10017098 | 3300010882 | Bacteria | 11360 |
| 103 | Ga0466735_072645 | 3300042624 | Bacteria | 6232 |
| 104 | Ga0466704_557681 | 3300042643 | Bacteria | 20638 |
| 105 | 2227273566 | 2225789004 | Bacteria | 1274 |
| 106 | IMNBL1DRAFT_c0009894 | 3300000062 | Bacteria | 4640 |
| 107 | JGI24705J35276_12178440 | 3300002504 | Bacteria | 1347 |
| 108 | JGI24699J35502_11134045 | 3300002509 | Bacteria | 26658 |
| 109 | Ga0466705_164363 | 3300042612 | Bacteria | 7729 |
| 110 | Ga0466692_067548 | 3300042591 | Bacteria | 10110 |
| 111 | Ga0466692_106596 | 3300042591 | Bacteria | 5339 |
| 112 | Ga0466705_391529 | 3300042612 | Bacteria | 3302 |
| 113 | Ga0466700_372371 | 3300042600 | Bacteria | 3166 |
| 114 | Ga0466707_263999 | 3300042601 | Bacteria | 16080 |
| 115 | Ga0466713_056151 | 3300042602 | Bacteria | 40882 |
| 116 | Ga0466716_467442 | 3300042605 | Bacteria | 25909 |
| 117 | Ga0123356_10104713 | 3300010049 | Bacteria | 2720 |
| 118 | Ga0123353_10438278 | 3300010167 | Bacteria | 1929 |
| 119 | Ga0123354_10005342 | 3300010882 | Bacteria | 18635 |
| 120 | Ga0123354_10019502 | 3300010882 | Bacteria | 10651 |
| 121 | Ga0123354_10082299 | 3300010882 | Bacteria | 4539 |
| 122 | Ga0123354_10182274 | 3300010882 | Unclassified | 2391 |
| 123 | Ga0466702_418845 | 3300042635 | Bacteria | 1312 |
| 124 | Ga0466703_058449 | 3300042636 | Bacteria | 2569 |
| 125 | Ga0466727_311789 | 3300042655 | Bacteria | 6585 |
| 126 | 2227474915 | 2225789004 | Bacteria | 4701 |
| 127 | 2227572419 | 2225789004 | Bacteria | 2600 |
| 128 | JGI24695J34938_10086437 | 3300002450 | Bacteria | 1291 |
| 129 | Ga0068305_10321584 | 3300005083 | Bacteria | 7639 |
| 130 | Ga0466705_284343 | 3300042612 | Bacteria | 14433 |
| 131 | Ga0466715_229277 | 3300042616 | Bacteria | 9485 |
| 132 | Ga0466700_102266 | 3300042600 | Bacteria | 11894 |
| 133 | Ga0466707_402013 | 3300042601 | Bacteria | 1855 |
| 134 | Ga0123357_10010334 | 3300009784 | Bacteria | 11862 |
| 135 | Ga0123357_10272177 | 3300009784 | Unclassified | 1767 |
| 136 | Ga0123354_10392232 | 3300010882 | Bacteria | 1185 |
| 137 | Ga0466703_069218 | 3300042636 | Bacteria | 5838 |
| 138 | Ga0466704_504980 | 3300042643 | Bacteria | 9197 |
| 139 | Ga0466709_218965 | 3300042648 | Bacteria | 23200 |
| 140 | Ga0466727_164388 | 3300042655 | Bacteria | 3664 |
| 141 | IMNBL1DRAFT_c0007528 | 3300000062 | Bacteria | 5707 |
| 142 | JGI24705J35276_12205976 | 3300002504 | Bacteria | 1710 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF01765 | RRF | Ribosome recycling factor | 54 | 151 | 0.97 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.