Protein Family IF07219
Metagenome
115
Members
33
Samples
110
Scaffolds
127.31
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_409593|Ga0466705_409593_21058_21498
- Length
- 146 aa
- Sequence
- MKKSRMKSPILTVTAAARKNMASDPRQIIAAICPELAASSSLDTFLGMAVELTDRGFFGKLYSYAVAYRACHLFMVSGGSGNGGVGEAAAGLGQIAGMSEGGLSVSFAAGGGSGDSGGLDTTKYGKLLLGLIKSRPTMGVNTAGLY
Sample Types
Isolate
0.0%
Metagenome
100.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
46.7%
Termitidae
30.0%
Rhinotermitidae
13.3%
Termopsidae
6.7%
Unclassified
3.3%
Taxonomy
Archaea
29
Bacteria
65
Eukaryota
0
Viruses
0
Unclassified
21
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 2 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 3 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 4 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 5 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 17 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 18 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 19 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 20 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 23 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 27 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 28 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 29 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 30 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 31 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 32 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 33 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_062113 | 3300042612 | Bacteria | 1350 |
| 2 | Ga0466711_078176 | 3300042615 | Bacteria | 8408 |
| 3 | Ga0466711_092487 | 3300042615 | Bacteria | 20698 |
| 4 | Ga0466718_169875 | 3300042617 | Bacteria | 1629 |
| 5 | Ga0466723_061028 | 3300042618 | Bacteria | 1664 |
| 6 | Ga0466728_406398 | 3300042620 | Bacteria | 6425 |
| 7 | Ga0466690_144288 | 3300042590 | Bacteria | 1551 |
| 8 | Ga0466690_182409 | 3300042590 | Unclassified | 1657 |
| 9 | Ga0466692_193527 | 3300042591 | Bacteria | 2787 |
| 10 | Ga0466696_418630 | 3300042596 | Bacteria | 2460 |
| 11 | Ga0466729_228815 | 3300042621 | Bacteria | 2467 |
| 12 | Ga0466704_393883 | 3300042643 | Bacteria | 4661 |
| 13 | AustNasuHG_c1000939 | 3300000089 | Bacteria | 10540 |
| 14 | Ga0072941_1007491 | 3300005201 | Bacteria | 73382 |
| 15 | Ga0466705_014682 | 3300042612 | Archaea | 8216 |
| 16 | Ga0123356_10018718 | 3300010049 | Bacteria | 6574 |
| 17 | Ga0466723_169962 | 3300042618 | Unclassified | 1039 |
| 18 | Ga0466723_324784 | 3300042618 | Bacteria | 1261 |
| 19 | Ga0466728_119504 | 3300042620 | Bacteria | 4581 |
| 20 | Ga0466690_079716 | 3300042590 | Unclassified | 1193 |
| 21 | Ga0466690_332193 | 3300042590 | Unclassified | 3003 |
| 22 | Ga0466691_099130 | 3300042593 | Archaea | 1790 |
| 23 | Ga0466716_170880 | 3300042605 | Bacteria | 5225 |
| 24 | Ga0466703_169196 | 3300042636 | Bacteria | 3168 |
| 25 | Ga0466704_591425 | 3300042643 | Bacteria | 1115 |
| 26 | Ga0466705_199898 | 3300042612 | Archaea | 2192 |
| 27 | Ga0466705_383244 | 3300042612 | Bacteria | 23824 |
| 28 | Ga0466715_340159 | 3300042616 | Bacteria | 2219 |
| 29 | Ga0466728_231297 | 3300042620 | Bacteria | 7558 |
| 30 | Ga0466693_129678 | 3300042592 | Bacteria | 15529 |
| 31 | Ga0466691_020180 | 3300042593 | Unclassified | 10963 |
| 32 | Ga0466707_404061 | 3300042601 | Bacteria | 2836 |
| 33 | Ga0466720_004918 | 3300042607 | Unclassified | 1009 |
| 34 | Ga0466703_135610 | 3300042636 | Bacteria | 39421 |
| 35 | Ga0466703_275732 | 3300042636 | Bacteria | 1264 |
| 36 | Ga0466704_247748 | 3300042643 | Bacteria | 7474 |
| 37 | FAAS_10004669 | 3300001880 | Unclassified | 888 |
| 38 | Ga0068302_10330582 | 3300005071 | Unclassified | 656 |
| 39 | Ga0072940_1262100 | 3300005200 | Bacteria | 2664 |
| 40 | Ga0466705_050031 | 3300042612 | Bacteria | 1812 |
| 41 | Ga0466705_456305 | 3300042612 | Bacteria | 13759 |
| 42 | Ga0466711_025125 | 3300042615 | Bacteria | 1353 |
| 43 | Ga0466690_013121 | 3300042590 | Archaea | 8797 |
| 44 | Ga0466690_019986 | 3300042590 | Archaea | 4899 |
| 45 | Ga0466691_048913 | 3300042593 | Archaea | 1426 |
| 46 | Ga0466696_003744 | 3300042596 | Bacteria | 3372 |
| 47 | Ga0466704_591317 | 3300042643 | Unclassified | 1177 |
| 48 | Ga0466709_126595 | 3300042648 | Archaea | 3125 |
| 49 | Ga0466709_161437 | 3300042648 | Archaea | 3282 |
| 50 | Ga0466709_416676 | 3300042648 | Bacteria | 18040 |
| 51 | Ga0466708_209399 | 3300042652 | Archaea | 1827 |
| 52 | Ga0466705_118260 | 3300042612 | Archaea | 1648 |
| 53 | Ga0466711_003064 | 3300042615 | Unclassified | 1871 |
| 54 | Ga0466711_242347 | 3300042615 | Archaea | 2860 |
| 55 | Ga0466711_342272 | 3300042615 | Bacteria | 7329 |
| 56 | Ga0466715_318689 | 3300042616 | Bacteria | 5753 |
| 57 | Ga0466718_057287 | 3300042617 | Bacteria | 1265 |
| 58 | Ga0466723_092866 | 3300042618 | Archaea | 15286 |
| 59 | Ga0466723_372484 | 3300042618 | Unclassified | 37143 |
| 60 | Ga0456237_0000228 | 3300041968 | Archaea | 8200 |
| 61 | Ga0466690_260864 | 3300042590 | Archaea | 7757 |
| 62 | Ga0466692_177325 | 3300042591 | Unclassified | 1095 |
| 63 | Ga0466691_160884 | 3300042593 | Bacteria | 11071 |
| 64 | Ga0466707_192430 | 3300042601 | Bacteria | 2506 |
| 65 | Ga0466704_129717 | 3300042643 | Bacteria | 1791 |
| 66 | Ga0466704_489113 | 3300042643 | Archaea | 3008 |
| 67 | Ga0466704_548903 | 3300042643 | Bacteria | 3053 |
| 68 | Ga0466708_014866 | 3300042652 | Archaea | 1285 |
| 69 | Ga0466708_099849 | 3300042652 | Bacteria | 4750 |
| 70 | AustNasuHG_c1001354 | 3300000089 | Bacteria | 8775 |
| 71 | Ga0466705_344127 | 3300042612 | Bacteria | 1901 |
| 72 | Ga0466715_246155 | 3300042616 | Archaea | 1186 |
| 73 | Ga0466723_071315 | 3300042618 | Bacteria | 1775 |
| 74 | Ga0466728_027564 | 3300042620 | Bacteria | 2824 |
| 75 | Ga0466696_026179 | 3300042596 | Bacteria | 5801 |
| 76 | Ga0466722_137594 | 3300042609 | Archaea | 3197 |
| 77 | Ga0466722_205040 | 3300042609 | Bacteria | 1186 |
| 78 | Ga0466703_312528 | 3300042636 | Unclassified | 3607 |
| 79 | Ga0466704_355182 | 3300042643 | Bacteria | 15452 |
| 80 | Ga0466704_461216 | 3300042643 | Archaea | 5080 |
| 81 | Ga0466709_279222 | 3300042648 | Archaea | 11755 |
| 82 | Ga0466709_372829 | 3300042648 | Bacteria | 11830 |
| 83 | Ga0466708_204310 | 3300042652 | Bacteria | 27782 |
| 84 | JGI24698J34947_10097411 | 3300002449 | Archaea | 1332 |
| 85 | Ga0072941_1010481 | 3300005201 | Bacteria | 50209 |
| 86 | Ga0072941_1041378 | 3300005201 | Bacteria | 2886 |
| 87 | Ga0466705_312974 | 3300042612 | Unclassified | 2068 |
| 88 | Ga0466705_409593 | 3300042612 | Bacteria | 22785 |
| 89 | Ga0466711_109552 | 3300042615 | Bacteria | 6454 |
| 90 | Ga0466711_511993 | 3300042615 | Unclassified | 1211 |
| 91 | Ga0466715_082133 | 3300042616 | Bacteria | 4813 |
| 92 | Ga0466723_069207 | 3300042618 | Bacteria | 2136 |
| 93 | Ga0466723_174152 | 3300042618 | Archaea | 1573 |
| 94 | Ga0466726_348601 | 3300042619 | Bacteria | 4327 |
| 95 | Ga0466728_438753 | 3300042620 | Archaea | 3183 |
| 96 | Ga0466692_116422 | 3300042591 | Bacteria | 1588 |
| 97 | Ga0466691_179551 | 3300042593 | Bacteria | 19150 |
| 98 | Ga0466696_447503 | 3300042596 | Bacteria | 4691 |
| 99 | Ga0466707_341259 | 3300042601 | Archaea | 1267 |
| 100 | Ga0466716_031593 | 3300042605 | Archaea | 6076 |
| 101 | Ga0466704_274432 | 3300042643 | Bacteria | 3849 |
| 102 | Ga0466712_278536 | 3300042614 | Archaea | 2523 |
| 103 | Ga0466723_053205 | 3300042618 | Archaea | 2407 |
| 104 | Ga0264413_156171 | 3300024493 | Archaea | 1574 |
| 105 | Ga0466690_034723 | 3300042590 | Bacteria | 1810 |
| 106 | Ga0466719_504983 | 3300042606 | Bacteria | 2737 |
| 107 | Ga0466722_233774 | 3300042609 | Unclassified | 1076 |
| 108 | Ga0466731_232365 | 3300042622 | Archaea | 1504 |
| 109 | Ga0466704_046555 | 3300042643 | Bacteria | 6981 |
| 110 | Ga0466708_285074 | 3300042652 | Bacteria | 24408 |
Family Sequences
| # | Sample | Scaffold | Protein | Length (aa) |
|---|---|---|---|---|
| 1 | 3300042618 | Ga0466723_174152 | Ga0466723_174152_334_660 | 108 |
| 2 | 3300042614 | Ga0466712_278536 | Ga0466712_278536_1149_1490 | 113 |
| 3 | 3300042617 | Ga0466718_057287 | Ga0466718_057287_150_533 | 117 |
| 4 | 3300042601 | Ga0466707_404061 | Ga0466707_404061_2266_2643 | 118 |
| 5 | 3300042615 | Ga0466711_092487 | Ga0466711_092487_747_1106 | 119 |
| 6 | 3300042643 | Ga0466704_591425 | Ga0466704_591425_409_771 | 120 |
| 7 | 3300042605 | Ga0466716_170880 | Ga0466716_170880_4433_4798 | 121 |
| 8 | 3300042609 | Ga0466722_233774 | Ga0466722_233774_196_603 | 121 |
| 9 | 3300042615 | Ga0466711_025125 | Ga0466711_025125_249_614 | 121 |
| 10 | 3300042620 | Ga0466728_438753 | Ga0466728_438753_1975_2370 | 121 |
| 11 | 3300042591 | Ga0466692_193527 | Ga0466692_193527_177_587 | 122 |
| 12 | 3300042591 | Ga0466692_193527 | Ga0466692_193527_177_587 | 122 |
| 13 | 3300042592 | Ga0466693_129678 | Ga0466693_129678_864_1232 | 122 |
| 14 | 3300042621 | Ga0466729_228815 | Ga0466729_228815_12_401 | 122 |
| 15 | 3300042643 | Ga0466704_355182 | Ga0466704_355182_13063_13461 | 122 |
| 16 | 3300042612 | Ga0466705_014682 | Ga0466705_014682_1048_1419 | 123 |
| 17 | 3300042618 | Ga0466723_324784 | Ga0466723_324784_149_520 | 123 |
| 18 | 3300042636 | Ga0466703_135610 | Ga0466703_135610_16873_17244 | 123 |
| 19 | 3300042636 | Ga0466703_169196 | Ga0466703_169196_625_996 | 123 |
| 20 | 3300042643 | Ga0466704_591317 | Ga0466704_591317_462_833 | 123 |
| 21 | 3300042593 | Ga0466691_179551 | Ga0466691_179551_10709_11104 | 124 |
| 22 | 3300000089 | AustNasuHG_c1000939 | AustNasuHG_100093910 | 125 |
| 23 | 3300042609 | Ga0466722_137594 | Ga0466722_137594_737_1114 | 125 |
| 24 | 3300042612 | Ga0466705_050031 | Ga0466705_050031_214_591 | 125 |
| 25 | 3300042612 | Ga0466705_050031 | Ga0466705_050031_214_591 | 125 |
| 26 | 3300042618 | Ga0466723_053205 | Ga0466723_053205_1591_1968 | 125 |
| 27 | 3300042622 | Ga0466731_232365 | Ga0466731_232365_223_600 | 125 |
| 28 | 3300042648 | Ga0466709_372829 | Ga0466709_372829_1979_2356 | 125 |
| 29 | 3300042652 | Ga0466708_204310 | Ga0466708_204310_14714_15091 | 125 |
| 30 | 3300002449 | JGI24698J34947_10097411 | JGI24698J34947_100974111 | 126 |
| 31 | 3300005201 | Ga0072941_1010481 | Ga0072941_101048140 | 126 |
| 32 | 3300042612 | Ga0466705_199898 | Ga0466705_199898_88_468 | 126 |
| 33 | 3300042612 | Ga0466705_344127 | Ga0466705_344127_30_410 | 126 |
| 34 | 3300042612 | Ga0466705_456305 | Ga0466705_456305_7177_7557 | 126 |
| 35 | 3300042615 | Ga0466711_242347 | Ga0466711_242347_1023_1403 | 126 |
| 36 | 3300042616 | Ga0466715_246155 | Ga0466715_246155_107_487 | 126 |
| 37 | 3300042616 | Ga0466715_318689 | Ga0466715_318689_432_812 | 126 |
| 38 | 3300042620 | Ga0466728_119504 | Ga0466728_119504_2924_3304 | 126 |
| 39 | 3300042643 | Ga0466704_489113 | Ga0466704_489113_2119_2499 | 126 |
| 40 | 3300042643 | Ga0466704_548903 | Ga0466704_548903_1849_2229 | 126 |
| 41 | 3300042648 | Ga0466709_416676 | Ga0466709_416676_12269_12649 | 126 |
| 42 | 3300000089 | AustNasuHG_c1001354 | AustNasuHG_100135410 | 127 |
| 43 | 3300042590 | Ga0466690_182409 | Ga0466690_182409_934_1317 | 127 |
| 44 | 3300042590 | Ga0466690_332193 | Ga0466690_332193_2278_2661 | 127 |
| 45 | 3300042593 | Ga0466691_020180 | Ga0466691_020180_3658_4041 | 127 |
| 46 | 3300042601 | Ga0466707_341259 | Ga0466707_341259_518_901 | 127 |
| 47 | 3300042615 | Ga0466711_003064 | Ga0466711_003064_808_1191 | 127 |
| 48 | 3300042615 | Ga0466711_109552 | Ga0466711_109552_3158_3541 | 127 |
| 49 | 3300042617 | Ga0466718_169875 | Ga0466718_169875_1076_1459 | 127 |
| 50 | 3300042618 | Ga0466723_069207 | Ga0466723_069207_1617_2000 | 127 |
| 51 | 3300042618 | Ga0466723_372484 | Ga0466723_372484_17189_17572 | 127 |
| 52 | 3300042620 | Ga0466728_406398 | Ga0466728_406398_246_629 | 127 |
| 53 | 3300042636 | Ga0466703_275732 | Ga0466703_275732_211_594 | 127 |
| 54 | 3300042643 | Ga0466704_129717 | Ga0466704_129717_1300_1683 | 127 |
| 55 | 3300005201 | Ga0072941_1041378 | Ga0072941_10413786 | 128 |
| 56 | 3300010049 | Ga0123356_10018718 | Ga0123356_100187186 | 128 |
| 57 | 3300024493 | Ga0264413_156171 | Ga0264413_1561712 | 128 |
| 58 | 3300042590 | Ga0466690_013121 | Ga0466690_013121_3526_3912 | 128 |
| 59 | 3300042590 | Ga0466690_019986 | Ga0466690_019986_3825_4211 | 128 |
| 60 | 3300042593 | Ga0466691_048913 | Ga0466691_048913_297_683 | 128 |
| 61 | 3300042606 | Ga0466719_504983 | Ga0466719_504983_1606_1992 | 128 |
| 62 | 3300042607 | Ga0466720_004918 | Ga0466720_004918_148_534 | 128 |
| 63 | 3300042609 | Ga0466722_205040 | Ga0466722_205040_476_862 | 128 |
| 64 | 3300042609 | Ga0466722_205040 | Ga0466722_205040_476_862 | 128 |
| 65 | 3300042612 | Ga0466705_312974 | Ga0466705_312974_475_861 | 128 |
| 66 | 3300042615 | Ga0466711_078176 | Ga0466711_078176_3739_4125 | 128 |
| 67 | 3300042615 | Ga0466711_342272 | Ga0466711_342272_4405_4791 | 128 |
| 68 | 3300042615 | Ga0466711_511993 | Ga0466711_511993_104_490 | 128 |
| 69 | 3300042618 | Ga0466723_169962 | Ga0466723_169962_135_521 | 128 |
| 70 | 3300042636 | Ga0466703_312528 | Ga0466703_312528_108_494 | 128 |
| 71 | 3300042643 | Ga0466704_046555 | Ga0466704_046555_2730_3116 | 128 |
| 72 | 3300042643 | Ga0466704_247748 | Ga0466704_247748_5411_5797 | 128 |
| 73 | 3300042643 | Ga0466704_461216 | Ga0466704_461216_3162_3548 | 128 |
| 74 | 3300042648 | Ga0466709_126595 | Ga0466709_126595_1968_2354 | 128 |
| 75 | 3300005200 | Ga0072940_1262100 | Ga0072940_12621005 | 129 |
| 76 | 3300005201 | Ga0072941_1007491 | Ga0072941_100749137 | 129 |
| 77 | 3300042590 | Ga0466690_034723 | Ga0466690_034723_1011_1400 | 129 |
| 78 | 3300042590 | Ga0466690_144288 | Ga0466690_144288_290_679 | 129 |
| 79 | 3300042593 | Ga0466691_099130 | Ga0466691_099130_1361_1750 | 129 |
| 80 | 3300042593 | Ga0466691_160884 | Ga0466691_160884_2745_3134 | 129 |
| 81 | 3300042596 | Ga0466696_418630 | Ga0466696_418630_582_971 | 129 |
| 82 | 3300042601 | Ga0466707_192430 | Ga0466707_192430_443_832 | 129 |
| 83 | 3300042612 | Ga0466705_062113 | Ga0466705_062113_693_1082 | 129 |
| 84 | 3300042616 | Ga0466715_082133 | Ga0466715_082133_723_1112 | 129 |
| 85 | 3300042616 | Ga0466715_340159 | Ga0466715_340159_1244_1633 | 129 |
| 86 | 3300042618 | Ga0466723_061028 | Ga0466723_061028_395_784 | 129 |
| 87 | 3300042648 | Ga0466709_161437 | Ga0466709_161437_1511_1900 | 129 |
| 88 | 3300042648 | Ga0466709_279222 | Ga0466709_279222_4860_5249 | 129 |
| 89 | 3300042652 | Ga0466708_014866 | Ga0466708_014866_282_671 | 129 |
| 90 | 3300042652 | Ga0466708_099849 | Ga0466708_099849_65_454 | 129 |
| 91 | 3300042652 | Ga0466708_209399 | Ga0466708_209399_232_621 | 129 |
| 92 | 3300042652 | Ga0466708_285074 | Ga0466708_285074_19202_19591 | 129 |
| 93 | 3300042590 | Ga0466690_260864 | Ga0466690_260864_2659_3051 | 130 |
| 94 | 3300042596 | Ga0466696_026179 | Ga0466696_026179_4027_4419 | 130 |
| 95 | 3300042605 | Ga0466716_031593 | Ga0466716_031593_5128_5520 | 130 |
| 96 | 3300042612 | Ga0466705_383244 | Ga0466705_383244_10571_10963 | 130 |
| 97 | 3300042618 | Ga0466723_092866 | Ga0466723_092866_986_1378 | 130 |
| 98 | 3300042643 | Ga0466704_393883 | Ga0466704_393883_1932_2324 | 130 |
| 99 | 3300001880 | FAAS_10004669 | FAAS_100046691 | 131 |
| 100 | 3300042596 | Ga0466696_003744 | Ga0466696_003744_460_855 | 131 |
| 101 | 3300042596 | Ga0466696_003744 | Ga0466696_003744_460_855 | 131 |
| 102 | 3300042618 | Ga0466723_071315 | Ga0466723_071315_264_659 | 131 |
| 103 | 3300042620 | Ga0466728_027564 | Ga0466728_027564_530_925 | 131 |
| 104 | 3300042590 | Ga0466690_079716 | Ga0466690_079716_332_730 | 132 |
| 105 | 3300042596 | Ga0466696_447503 | Ga0466696_447503_1722_2120 | 132 |
| 106 | 3300042612 | Ga0466705_118260 | Ga0466705_118260_692_1093 | 133 |
| 107 | 3300042643 | Ga0466704_274432 | Ga0466704_274432_2325_2726 | 133 |
| 108 | 3300042619 | Ga0466726_348601 | Ga0466726_348601_747_1151 | 134 |
| 109 | 3300042591 | Ga0466692_116422 | Ga0466692_116422_773_1180 | 135 |
| 110 | 3300005071 | Ga0068302_10330582 | Ga0068302_103305821 | 136 |
| 111 | 3300042591 | Ga0466692_177325 | Ga0466692_177325_634_1047 | 137 |
| 112 | 3300042620 | Ga0466728_231297 | Ga0466728_231297_4506_4919 | 137 |
| 113 | 3300042620 | Ga0466728_231297 | Ga0466728_231297_4506_4919 | 137 |
| 114 | 3300041968 | Ga0456237_0000228 | Ga0456237_0000228_5637_6062 | 141 |
| 115 | 3300042612 | Ga0466705_409593 | Ga0466705_409593_21058_21498 | 146 |
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13262 | DUF4054 | Protein of unknown function (DUF4054) | 40 | 132 | 0.88 |
Structure & Feature Viewer
| pLDDT | pTM | Quality |
|---|---|---|
| 0.58 | 0.82 | High |
Powered by Feature Viewer
Powered by PDBe Molstar
Geographic Distribution
Some samples may be missing due to lack of coordinate data.