Protein Family IF07208
Metagenome
Isolate
107
Members
27
Samples
106
Scaffolds
181.31
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_374407|Ga0466705_374407_50_658
- Length
- 202 aa
- Sequence
- MKTEDFVLVRLDSDAVVALFDCGNDDLNDFLINDAALYQKERFAVTHVIVPLCNAGTIQIAGYFCLLTDKLAFDPSDEKQRKAWKTFNKQNKIHFNKHRKTYPSIKIGRLAVATTFAKQGLGRYIMSCIIYIIISIDNIGCRFITVDAYKSAFDFYLKNDFRFLSSEDESEETRVMYFDLKRYTMLIDELLSPTYRLLFPPV
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
40.7%
Termitidae
22.2%
Unclassified
14.8%
Termopsidae
14.8%
Passalidae
3.7%
Rhinotermitidae
3.7%
Taxonomy
Archaea
1
Bacteria
95
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 2 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 3 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 4 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 8 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 11 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 12 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 13 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 14 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 15 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 16 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 17 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 18 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 19 | 3300042623 | Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 | Metagenome | Termitidae |
| 20 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 21 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 22 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 23 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 24 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 25 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 26 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 27 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466690_352170 | 3300042590 | Bacteria | 1363 |
| 2 | Ga0466691_115948 | 3300042593 | Bacteria | 1511 |
| 3 | Ga0466711_149727 | 3300042615 | Bacteria | 2453 |
| 4 | Ga0466711_204350 | 3300042615 | Unclassified | 3832 |
| 5 | Ga0466711_230780 | 3300042615 | Bacteria | 1111 |
| 6 | Ga0466726_239320 | 3300042619 | Bacteria | 1716 |
| 7 | Ga0466707_131270 | 3300042601 | Bacteria | 23399 |
| 8 | Ga0466707_266318 | 3300042601 | Bacteria | 1258 |
| 9 | Ga0466713_034219 | 3300042602 | Bacteria | 3496 |
| 10 | Ga0466713_036443 | 3300042602 | Bacteria | 1397 |
| 11 | Ga0466714_001752 | 3300042603 | Bacteria | 1341 |
| 12 | Ga0466719_500063 | 3300042606 | Bacteria | 1175 |
| 13 | Ga0068305_10006957 | 3300005083 | Bacteria | 11216 |
| 14 | Ga0466705_374407 | 3300042612 | Bacteria | 2136 |
| 15 | Ga0466711_074167 | 3300042615 | Bacteria | 2612 |
| 16 | Ga0466711_086493 | 3300042615 | Archaea | 3366 |
| 17 | Ga0466715_162938 | 3300042616 | Bacteria | 8464 |
| 18 | Ga0466728_274165 | 3300042620 | Bacteria | 15277 |
| 19 | Ga0466719_298066 | 3300042606 | Unclassified | 1605 |
| 20 | Ga0466719_405753 | 3300042606 | Bacteria | 1063 |
| 21 | Ga0068305_10476984 | 3300005083 | Unclassified | 711 |
| 22 | Ga0466729_239815 | 3300042621 | Bacteria | 1186 |
| 23 | Ga0466734_147344 | 3300042623 | Bacteria | 1490 |
| 24 | Ga0466690_276223 | 3300042590 | Bacteria | 213056 |
| 25 | Ga0466691_057342 | 3300042593 | Bacteria | 1869 |
| 26 | Ga0466711_011624 | 3300042615 | Bacteria | 6977 |
| 27 | Ga0466711_032755 | 3300042615 | Bacteria | 36049 |
| 28 | Ga0466711_166828 | 3300042615 | Bacteria | 1748 |
| 29 | Ga0466707_023321 | 3300042601 | Bacteria | 4891 |
| 30 | Ga0466707_039862 | 3300042601 | Bacteria | 1247 |
| 31 | Ga0466707_118854 | 3300042601 | Bacteria | 1262 |
| 32 | Ga0466719_027467 | 3300042606 | Bacteria | 1611 |
| 33 | Ga0466719_446021 | 3300042606 | Bacteria | 1374 |
| 34 | Ga0466735_156075 | 3300042624 | Unclassified | 1604 |
| 35 | Ga0466735_181585 | 3300042624 | Bacteria | 2466 |
| 36 | Ga0466703_163067 | 3300042636 | Bacteria | 3366 |
| 37 | Ga0466704_023818 | 3300042643 | Bacteria | 15020 |
| 38 | Ga0466704_070084 | 3300042643 | Bacteria | 1357 |
| 39 | Ga0466727_106535 | 3300042655 | Bacteria | 2563 |
| 40 | Ga0466711_077305 | 3300042615 | Bacteria | 2733 |
| 41 | Ga0466711_108096 | 3300042615 | Bacteria | 16742 |
| 42 | Ga0466711_130864 | 3300042615 | Bacteria | 2643 |
| 43 | Ga0466711_329786 | 3300042615 | Unclassified | 1173 |
| 44 | Ga0466711_388528 | 3300042615 | Bacteria | 1333 |
| 45 | Ga0466711_437771 | 3300042615 | Bacteria | 1289 |
| 46 | Ga0466707_203462 | 3300042601 | Bacteria | 2616 |
| 47 | Ga0466707_226787 | 3300042601 | Bacteria | 17750 |
| 48 | Ga0466713_028662 | 3300042602 | Bacteria | 23021 |
| 49 | Ga0466713_052265 | 3300042602 | Bacteria | 2802 |
| 50 | Ga0466714_031186 | 3300042603 | Bacteria | 1148 |
| 51 | Ga0466719_341122 | 3300042606 | Bacteria | 1240 |
| 52 | Ga0123353_10002921 | 3300010167 | Bacteria | 21404 |
| 53 | Ga0123354_10339627 | 3300010882 | Bacteria | 1355 |
| 54 | IMNBL1DRAFT_c0002452 | 3300000062 | Bacteria | 12900 |
| 55 | Ga0068302_10060312 | 3300005071 | Unclassified | 1814 |
| 56 | Ga0068305_10476176 | 3300005083 | Bacteria | 977 |
| 57 | Ga0466729_253337 | 3300042621 | Bacteria | 1538 |
| 58 | Ga0466727_033690 | 3300042655 | Bacteria | 21432 |
| 59 | Ga0466711_163410 | 3300042615 | Bacteria | 1391 |
| 60 | Ga0466711_431502 | 3300042615 | Bacteria | 10076 |
| 61 | Ga0466711_459607 | 3300042615 | Bacteria | 1192 |
| 62 | Ga0466726_215810 | 3300042619 | Bacteria | 1029 |
| 63 | Ga0466707_248165 | 3300042601 | Bacteria | 1744 |
| 64 | Ga0466707_299826 | 3300042601 | Bacteria | 1394 |
| 65 | Ga0466713_026021 | 3300042602 | Bacteria | 2524 |
| 66 | Ga0123354_10004657 | 3300010882 | Bacteria | 19538 |
| 67 | Ga0466731_324844 | 3300042622 | Bacteria | 1502 |
| 68 | Ga0466735_045560 | 3300042624 | Bacteria | 1240 |
| 69 | Ga0466704_263939 | 3300042643 | Bacteria | 6064 |
| 70 | Ga0466727_165094 | 3300042655 | Bacteria | 3170 |
| 71 | Ga0466705_121305 | 3300042612 | Bacteria | 1395 |
| 72 | Ga0466705_294834 | 3300042612 | Unclassified | 1208 |
| 73 | Ga0466733_024263 | 3300042659 | Bacteria | 5894 |
| 74 | Ga0466733_195814 | 3300042659 | Bacteria | 2735 |
| 75 | Ga0466691_057313 | 3300042593 | Bacteria | 7402 |
| 76 | Ga0466711_093377 | 3300042615 | Bacteria | 7250 |
| 77 | Ga0466711_320271 | 3300042615 | Bacteria | 1045 |
| 78 | Ga0466726_095292 | 3300042619 | Bacteria | 1066 |
| 79 | Ga0466707_138317 | 3300042601 | Bacteria | 1372 |
| 80 | Ga0466719_074812 | 3300042606 | Bacteria | 1246 |
| 81 | Ga0466719_371008 | 3300042606 | Bacteria | 2303 |
| 82 | Ga0068305_10013231 | 3300005083 | Unclassified | 859 |
| 83 | Ga0068305_10032522 | 3300005083 | Bacteria | 13312 |
| 84 | Ga0466709_029239 | 3300042648 | Bacteria | 1529 |
| 85 | Ga0466691_036704 | 3300042593 | Bacteria | 9460 |
| 86 | Ga0466711_088296 | 3300042615 | Bacteria | 1760 |
| 87 | Ga0466711_172654 | 3300042615 | Bacteria | 2370 |
| 88 | Ga0466716_267950 | 3300042605 | Unclassified | 1846 |
| 89 | Ga0466735_126492 | 3300042624 | Bacteria | 1047 |
| 90 | Ga0466735_191597 | 3300042624 | Bacteria | 1129 |
| 91 | Ga0466733_082464 | 3300042659 | Bacteria | 12902 |
| 92 | Ga0466691_042880 | 3300042593 | Bacteria | 6612 |
| 93 | Ga0466711_260073 | 3300042615 | Bacteria | 1536 |
| 94 | Ga0466711_389893 | 3300042615 | Bacteria | 1088 |
| 95 | Ga0466711_413161 | 3300042615 | Bacteria | 1171 |
| 96 | Ga0466726_343661 | 3300042619 | Bacteria | 9545 |
| 97 | Ga0466728_213683 | 3300042620 | Unclassified | 1523 |
| 98 | Ga0466713_068025 | 3300042602 | Bacteria | 10658 |
| 99 | Ga0466713_118181 | 3300042602 | Bacteria | 33659 |
| 100 | Ga0466719_245020 | 3300042606 | Bacteria | 1789 |
| 101 | Ga0466719_472765 | 3300042606 | Bacteria | 1166 |
| 102 | Ga0466735_031603 | 3300042624 | Bacteria | 1125 |
| 103 | Ga0466735_149082 | 3300042624 | Bacteria | 2263 |
| 104 | Ga0466703_322116 | 3300042636 | Bacteria | 1817 |
| 105 | Ga0466704_386165 | 3300042643 | Unclassified | 4026 |
| 106 | Ga0466727_272517 | 3300042655 | Bacteria | 5123 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.