Protein Family IF07192
Metagenome
Isolate
120
Members
29
Samples
106
Scaffolds
241.12
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_322637|Ga0466705_322637_1675_2532
- Length
- 285 aa
- Sequence
- MQQNAGIRKGRDARDGVFFRCRARFIFATRRFTPRFARFRLSGFMTIYPAIDIKGGCCVRLTQGRADQQTVYSKNPAGVAAQFKAAGAGWVHVVDLDGAFSGESQNLGVVREIIRAGMRVQLGGGVRTREAAERALGLGVTRVVVGTRAAESEDFVRELVTAFGERIAVGIDARNGLVAVKGWVATTGTSALTLAQRMDALGVKTLVYTDISTDGMLTGPNLAAQEAMLMAVKCRVIASGGVSRQEDVGLLGRLARRYANLDGVIIGKAIYEKRVDLVQAIAEEV
Sample Types
Isolate
11.7%
Metagenome
88.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Unclassified
40.7%
Termitidae
33.3%
Kalotermitidae
7.4%
Blattidae
7.4%
Termopsidae
7.4%
Rhinotermitidae
3.7%
Taxonomy
Archaea
2
Bacteria
116
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2508501067 | Opitutaceae bacterium TAV1 | Isolate | Unclassified |
| 2 | 2639763186 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 3 | 2820018428 | Unclassified Spirochaetes Nt197P3bin33 | Isolate | Unclassified |
| 4 | 2820442516 | Unclassified Firmicutes Lab288P3bin200 | Isolate | Unclassified |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 7 | 2857493320 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 8 | 2820249082 | Unclassified Firmicutes Th196P3bin69 | Isolate | Unclassified |
| 9 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 10 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 11 | 2940377351 | Ereboglobus sp. PH5-5 | Isolate | Blattidae |
| 12 | 2820220859 | Unclassified Firmicutes Th196P4bin59 | Isolate | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 15 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 16 | 2857498920 | Opitutaceae bacterium TAV4 | Isolate | Unclassified |
| 17 | 2940239174 | Ereboglobus sp. PH5-10 | Isolate | Blattidae |
| 18 | 2517572100 | Geminisphaera colitermitum TAV2 | Isolate | Unclassified |
| 19 | 2820566695 | Unclassified Firmicutes Emb289P3bin50 | Isolate | Unclassified |
| 20 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 21 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 22 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 23 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 2639763185 | Opitutaceae bacterium TAV3 | Isolate | Unclassified |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0123356_10008707 | 3300010049 | Bacteria | 10064 |
| 2 | Ga0123356_10054321 | 3300010049 | Bacteria | 3731 |
| 3 | Ga0123356_10065709 | 3300010049 | Bacteria | 3394 |
| 4 | Ga0123356_10093577 | 3300010049 | Bacteria | 2869 |
| 5 | Ga0123353_10008024 | 3300010167 | Bacteria | 14364 |
| 6 | Ga0123353_10067673 | 3300010167 | Bacteria | 5736 |
| 7 | Ga0123353_10299802 | 3300010167 | Bacteria | 2454 |
| 8 | Ga0123354_10394788 | 3300010882 | Bacteria | 1178 |
| 9 | Ga0072941_1531267 | 3300005201 | Unclassified | 1912 |
| 10 | Ga0466733_111027 | 3300042659 | Bacteria | 27007 |
| 11 | Ga0415639_050169 | 3300038395 | Bacteria | 2021 |
| 12 | Ga0415639_119745 | 3300038395 | Bacteria | 6143 |
| 13 | Ga0466721_368405 | 3300042608 | Bacteria | 2471 |
| 14 | Ga0123356_10000428 | 3300010049 | Bacteria | 48108 |
| 15 | Ga0123356_10123034 | 3300010049 | Bacteria | 2527 |
| 16 | Ga0123356_10173410 | 3300010049 | Bacteria | 2170 |
| 17 | Ga0123356_10314591 | 3300010049 | Bacteria | 1676 |
| 18 | Ga0123356_10483286 | 3300010049 | Bacteria | 1392 |
| 19 | Ga0123353_10005073 | 3300010167 | Bacteria | 17184 |
| 20 | Ga0123353_10008470 | 3300010167 | Bacteria | 14050 |
| 21 | Ga0123353_10045563 | 3300010167 | Bacteria | 6961 |
| 22 | Ga0123353_11277073 | 3300010167 | Bacteria | 955 |
| 23 | JGI24702J35022_10000401 | 3300002462 | Bacteria | 25766 |
| 24 | Ga0466722_056670 | 3300042609 | Bacteria | 43721 |
| 25 | Ga0466704_169837 | 3300042643 | Bacteria | 21994 |
| 26 | Ga0123356_10021713 | 3300010049 | Bacteria | 6059 |
| 27 | Ga0123356_10181268 | 3300010049 | Bacteria | 2128 |
| 28 | Ga0123356_10188912 | 3300010049 | Bacteria | 2089 |
| 29 | Ga0123356_10228764 | 3300010049 | Bacteria | 1922 |
| 30 | Ga0123353_10497530 | 3300010167 | Bacteria | 1777 |
| 31 | Ga0264413_147390 | 3300024493 | Archaea | 5713 |
| 32 | Ga0123355_10128003 | 3300009826 | Bacteria | 3919 |
| 33 | Ga0123355_10473863 | 3300009826 | Bacteria | 1562 |
| 34 | Ga0123356_10005020 | 3300010049 | Bacteria | 13566 |
| 35 | Ga0123356_10015847 | 3300010049 | Bacteria | 7213 |
| 36 | Ga0123356_10026054 | 3300010049 | Bacteria | 5496 |
| 37 | Ga0123356_10044142 | 3300010049 | Bacteria | 4149 |
| 38 | Ga0123356_10214564 | 3300010049 | Bacteria | 1976 |
| 39 | Ga0123356_10392083 | 3300010049 | Bacteria | 1524 |
| 40 | Ga0123356_10576208 | 3300010049 | Bacteria | 1288 |
| 41 | Ga0123356_11565661 | 3300010049 | Bacteria | 815 |
| 42 | Ga0123353_10098404 | 3300010167 | Bacteria | 4714 |
| 43 | Ga0123353_10112396 | 3300010167 | Bacteria | 4386 |
| 44 | Ga0123353_10185411 | 3300010167 | Bacteria | 3291 |
| 45 | Ga0123353_10338425 | 3300010167 | Bacteria | 2274 |
| 46 | Ga0415639_032949 | 3300038395 | Bacteria | 17877 |
| 47 | Ga0466704_130370 | 3300042643 | Unclassified | 7942 |
| 48 | Ga0123355_10011047 | 3300009826 | Bacteria | 13899 |
| 49 | Ga0123355_10529510 | 3300009826 | Bacteria | 1437 |
| 50 | Ga0123356_10000242 | 3300010049 | Bacteria | 62970 |
| 51 | Ga0123356_10005549 | 3300010049 | Bacteria | 12829 |
| 52 | Ga0123356_10006221 | 3300010049 | Bacteria | 12065 |
| 53 | Ga0123356_10027911 | 3300010049 | Bacteria | 5289 |
| 54 | Ga0123356_10037692 | 3300010049 | Bacteria | 4508 |
| 55 | Ga0123356_10085804 | 3300010049 | Bacteria | 2987 |
| 56 | Ga0123356_10141372 | 3300010049 | Bacteria | 2375 |
| 57 | Ga0123356_10326485 | 3300010049 | Bacteria | 1649 |
| 58 | Ga0123356_10347447 | 3300010049 | Bacteria | 1606 |
| 59 | Ga0123356_10539665 | 3300010049 | Bacteria | 1326 |
| 60 | Ga0123356_10758449 | 3300010049 | Archaea | 1140 |
| 61 | Ga0123356_10833845 | 3300010049 | Bacteria | 1093 |
| 62 | Ga0123353_10046266 | 3300010167 | Bacteria | 6912 |
| 63 | Ga0123353_10794447 | 3300010167 | Bacteria | 1308 |
| 64 | Ga0123353_11207905 | 3300010167 | Bacteria | 991 |
| 65 | Ga0466705_322637 | 3300042612 | Bacteria | 3260 |
| 66 | Ga0415639_148000 | 3300038395 | Bacteria | 5768 |
| 67 | Ga0123355_10909008 | 3300009826 | Bacteria | 954 |
| 68 | Ga0123356_10000210 | 3300010049 | Bacteria | 68021 |
| 69 | Ga0123356_10012353 | 3300010049 | Bacteria | 8290 |
| 70 | Ga0123356_10034322 | 3300010049 | Bacteria | 4742 |
| 71 | Ga0123356_10172600 | 3300010049 | Bacteria | 2174 |
| 72 | Ga0123356_10576207 | 3300010049 | Bacteria | 1288 |
| 73 | Ga0123353_10028790 | 3300010167 | Bacteria | 8543 |
| 74 | Ga0123353_10533275 | 3300010167 | Bacteria | 1699 |
| 75 | Ga0466726_122125 | 3300042619 | Bacteria | 5789 |
| 76 | Ga0415639_037012 | 3300038395 | Bacteria | 3205 |
| 77 | Ga0415639_087856 | 3300038395 | Bacteria | 2050 |
| 78 | Ga0123356_10063054 | 3300010049 | Bacteria | 3463 |
| 79 | Ga0123356_10077463 | 3300010049 | Bacteria | 3136 |
| 80 | Ga0123356_10079548 | 3300010049 | Bacteria | 3097 |
| 81 | Ga0123356_10097554 | 3300010049 | Bacteria | 2813 |
| 82 | Ga0123356_10109416 | 3300010049 | Bacteria | 2666 |
| 83 | Ga0123353_10435806 | 3300010167 | Bacteria | 1936 |
| 84 | Ga0123353_10545697 | 3300010167 | Bacteria | 1674 |
| 85 | Ga0123353_11374166 | 3300010167 | Bacteria | 910 |
| 86 | Ga0123354_10264826 | 3300010882 | Bacteria | 1707 |
| 87 | Ga0415639_006837 | 3300038395 | Bacteria | 60618 |
| 88 | Ga0415639_091392 | 3300038395 | Bacteria | 1186 |
| 89 | Ga0415639_141230 | 3300038395 | Bacteria | 2202 |
| 90 | Ga0415639_237598 | 3300038395 | Bacteria | 2069 |
| 91 | Ga0466725_249419 | 3300042654 | Bacteria | 1045 |
| 92 | Ga0466727_030641 | 3300042655 | Bacteria | 3691 |
| 93 | Ga0123356_10000010 | 3300010049 | Bacteria | 220063 |
| 94 | Ga0123356_10003277 | 3300010049 | Bacteria | 17007 |
| 95 | Ga0123356_10141811 | 3300010049 | Bacteria | 2371 |
| 96 | Ga0123356_10161538 | 3300010049 | Bacteria | 2238 |
| 97 | Ga0123356_10271944 | 3300010049 | Bacteria | 1785 |
| 98 | Ga0123356_10302665 | 3300010049 | Bacteria | 1704 |
| 99 | Ga0123356_10642455 | 3300010049 | Bacteria | 1228 |
| 100 | Ga0123356_10929079 | 3300010049 | Bacteria | 1041 |
| 101 | Ga0123356_11316908 | 3300010049 | Bacteria | 885 |
| 102 | Ga0123356_11683296 | 3300010049 | Bacteria | 787 |
| 103 | Ga0123353_10062080 | 3300010167 | Bacteria | 5993 |
| 104 | Ga0123353_10343202 | 3300010167 | Bacteria | 2254 |
| 105 | Ga0123353_10592690 | 3300010167 | Bacteria | 1587 |
| 106 | Ga0123353_11376792 | 3300010167 | Bacteria | 909 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00977 | His_biosynth | Histidine biosynthesis protein | 47 | 275 | 0.97 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00977 | GO:0000105 | L-histidine biosynthetic process | BP |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.