Protein Family IF07192

Metagenome Isolate
120 Members
29 Samples
106 Scaffolds
241.12 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_322637|Ga0466705_322637_1675_2532
Length
285 aa
Sequence
MQQNAGIRKGRDARDGVFFRCRARFIFATRRFTPRFARFRLSGFMTIYPAIDIKGGCCVRLTQGRADQQTVYSKNPAGVAAQFKAAGAGWVHVVDLDGAFSGESQNLGVVREIIRAGMRVQLGGGVRTREAAERALGLGVTRVVVGTRAAESEDFVRELVTAFGERIAVGIDARNGLVAVKGWVATTGTSALTLAQRMDALGVKTLVYTDISTDGMLTGPNLAAQEAMLMAVKCRVIASGGVSRQEDVGLLGRLARRYANLDGVIIGKAIYEKRVDLVQAIAEEV

πŸ“Š Sample Types

Isolate 11.7%
Metagenome 88.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

πŸ› Taxa Family Distribution

Unclassified 40.7%
Termitidae 33.3%
Kalotermitidae 7.4%
Blattidae 7.4%
Termopsidae 7.4%
Rhinotermitidae 3.7%

🌳 Taxonomy

Archaea 2
Bacteria 116
Eukaryota 0
Viruses 0
Unclassified 2

πŸ—‚οΈ Samples

#Sample IDDescriptionTypeTaxa Family
1 2508501067 Opitutaceae bacterium TAV1 Isolate Unclassified
2 2639763186 Opitutaceae bacterium TAV4 Isolate Unclassified
3 2820018428 Unclassified Spirochaetes Nt197P3bin33 Isolate Unclassified
4 2820442516 Unclassified Firmicutes Lab288P3bin200 Isolate Unclassified
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
7 2857493320 Opitutaceae bacterium TAV3 Isolate Unclassified
8 2820249082 Unclassified Firmicutes Th196P3bin69 Isolate Unclassified
9 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
10 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
11 2940377351 Ereboglobus sp. PH5-5 Isolate Blattidae
12 2820220859 Unclassified Firmicutes Th196P4bin59 Isolate Unclassified
13 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
14 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
15 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
16 2857498920 Opitutaceae bacterium TAV4 Isolate Unclassified
17 2940239174 Ereboglobus sp. PH5-10 Isolate Blattidae
18 2517572100 Geminisphaera colitermitum TAV2 Isolate Unclassified
19 2820566695 Unclassified Firmicutes Emb289P3bin50 Isolate Unclassified
20 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae
21 3300042654 Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 Metagenome Termitidae
22 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
23 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
24 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
25 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
26 2639763185 Opitutaceae bacterium TAV3 Isolate Unclassified
27 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
28 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
29 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome

πŸ”— Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123356_10008707 3300010049 Bacteria 10064
2 Ga0123356_10054321 3300010049 Bacteria 3731
3 Ga0123356_10065709 3300010049 Bacteria 3394
4 Ga0123356_10093577 3300010049 Bacteria 2869
5 Ga0123353_10008024 3300010167 Bacteria 14364
6 Ga0123353_10067673 3300010167 Bacteria 5736
7 Ga0123353_10299802 3300010167 Bacteria 2454
8 Ga0123354_10394788 3300010882 Bacteria 1178
9 Ga0072941_1531267 3300005201 Unclassified 1912
10 Ga0466733_111027 3300042659 Bacteria 27007
11 Ga0415639_050169 3300038395 Bacteria 2021
12 Ga0415639_119745 3300038395 Bacteria 6143
13 Ga0466721_368405 3300042608 Bacteria 2471
14 Ga0123356_10000428 3300010049 Bacteria 48108
15 Ga0123356_10123034 3300010049 Bacteria 2527
16 Ga0123356_10173410 3300010049 Bacteria 2170
17 Ga0123356_10314591 3300010049 Bacteria 1676
18 Ga0123356_10483286 3300010049 Bacteria 1392
19 Ga0123353_10005073 3300010167 Bacteria 17184
20 Ga0123353_10008470 3300010167 Bacteria 14050
21 Ga0123353_10045563 3300010167 Bacteria 6961
22 Ga0123353_11277073 3300010167 Bacteria 955
23 JGI24702J35022_10000401 3300002462 Bacteria 25766
24 Ga0466722_056670 3300042609 Bacteria 43721
25 Ga0466704_169837 3300042643 Bacteria 21994
26 Ga0123356_10021713 3300010049 Bacteria 6059
27 Ga0123356_10181268 3300010049 Bacteria 2128
28 Ga0123356_10188912 3300010049 Bacteria 2089
29 Ga0123356_10228764 3300010049 Bacteria 1922
30 Ga0123353_10497530 3300010167 Bacteria 1777
31 Ga0264413_147390 3300024493 Archaea 5713
32 Ga0123355_10128003 3300009826 Bacteria 3919
33 Ga0123355_10473863 3300009826 Bacteria 1562
34 Ga0123356_10005020 3300010049 Bacteria 13566
35 Ga0123356_10015847 3300010049 Bacteria 7213
36 Ga0123356_10026054 3300010049 Bacteria 5496
37 Ga0123356_10044142 3300010049 Bacteria 4149
38 Ga0123356_10214564 3300010049 Bacteria 1976
39 Ga0123356_10392083 3300010049 Bacteria 1524
40 Ga0123356_10576208 3300010049 Bacteria 1288
41 Ga0123356_11565661 3300010049 Bacteria 815
42 Ga0123353_10098404 3300010167 Bacteria 4714
43 Ga0123353_10112396 3300010167 Bacteria 4386
44 Ga0123353_10185411 3300010167 Bacteria 3291
45 Ga0123353_10338425 3300010167 Bacteria 2274
46 Ga0415639_032949 3300038395 Bacteria 17877
47 Ga0466704_130370 3300042643 Unclassified 7942
48 Ga0123355_10011047 3300009826 Bacteria 13899
49 Ga0123355_10529510 3300009826 Bacteria 1437
50 Ga0123356_10000242 3300010049 Bacteria 62970
51 Ga0123356_10005549 3300010049 Bacteria 12829
52 Ga0123356_10006221 3300010049 Bacteria 12065
53 Ga0123356_10027911 3300010049 Bacteria 5289
54 Ga0123356_10037692 3300010049 Bacteria 4508
55 Ga0123356_10085804 3300010049 Bacteria 2987
56 Ga0123356_10141372 3300010049 Bacteria 2375
57 Ga0123356_10326485 3300010049 Bacteria 1649
58 Ga0123356_10347447 3300010049 Bacteria 1606
59 Ga0123356_10539665 3300010049 Bacteria 1326
60 Ga0123356_10758449 3300010049 Archaea 1140
61 Ga0123356_10833845 3300010049 Bacteria 1093
62 Ga0123353_10046266 3300010167 Bacteria 6912
63 Ga0123353_10794447 3300010167 Bacteria 1308
64 Ga0123353_11207905 3300010167 Bacteria 991
65 Ga0466705_322637 3300042612 Bacteria 3260
66 Ga0415639_148000 3300038395 Bacteria 5768
67 Ga0123355_10909008 3300009826 Bacteria 954
68 Ga0123356_10000210 3300010049 Bacteria 68021
69 Ga0123356_10012353 3300010049 Bacteria 8290
70 Ga0123356_10034322 3300010049 Bacteria 4742
71 Ga0123356_10172600 3300010049 Bacteria 2174
72 Ga0123356_10576207 3300010049 Bacteria 1288
73 Ga0123353_10028790 3300010167 Bacteria 8543
74 Ga0123353_10533275 3300010167 Bacteria 1699
75 Ga0466726_122125 3300042619 Bacteria 5789
76 Ga0415639_037012 3300038395 Bacteria 3205
77 Ga0415639_087856 3300038395 Bacteria 2050
78 Ga0123356_10063054 3300010049 Bacteria 3463
79 Ga0123356_10077463 3300010049 Bacteria 3136
80 Ga0123356_10079548 3300010049 Bacteria 3097
81 Ga0123356_10097554 3300010049 Bacteria 2813
82 Ga0123356_10109416 3300010049 Bacteria 2666
83 Ga0123353_10435806 3300010167 Bacteria 1936
84 Ga0123353_10545697 3300010167 Bacteria 1674
85 Ga0123353_11374166 3300010167 Bacteria 910
86 Ga0123354_10264826 3300010882 Bacteria 1707
87 Ga0415639_006837 3300038395 Bacteria 60618
88 Ga0415639_091392 3300038395 Bacteria 1186
89 Ga0415639_141230 3300038395 Bacteria 2202
90 Ga0415639_237598 3300038395 Bacteria 2069
91 Ga0466725_249419 3300042654 Bacteria 1045
92 Ga0466727_030641 3300042655 Bacteria 3691
93 Ga0123356_10000010 3300010049 Bacteria 220063
94 Ga0123356_10003277 3300010049 Bacteria 17007
95 Ga0123356_10141811 3300010049 Bacteria 2371
96 Ga0123356_10161538 3300010049 Bacteria 2238
97 Ga0123356_10271944 3300010049 Bacteria 1785
98 Ga0123356_10302665 3300010049 Bacteria 1704
99 Ga0123356_10642455 3300010049 Bacteria 1228
100 Ga0123356_10929079 3300010049 Bacteria 1041
101 Ga0123356_11316908 3300010049 Bacteria 885
102 Ga0123356_11683296 3300010049 Bacteria 787
103 Ga0123353_10062080 3300010167 Bacteria 5993
104 Ga0123353_10343202 3300010167 Bacteria 2254
105 Ga0123353_10592690 3300010167 Bacteria 1587
106 Ga0123353_11376792 3300010167 Bacteria 909

🧩 MSA Aligner

πŸ”¬ Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00977 His_biosynth Histidine biosynthesis protein 47 275 0.97

🌐 Gene Ontology Annotation

PFAMGO TermDescriptionCategory
PF00977 GO:0000105 L-histidine biosynthetic process BP

πŸ—ΊοΈ Geographic Distribution

Some samples may be missing due to lack of coordinate data.