Protein Family IF07135
Metagenome
Isolate
150
Members
52
Samples
144
Scaffolds
74.83
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_186745|Ga0466705_186745_1282_1512
- Length
- 76 aa
- Sequence
- MPEPAKRDPKAPRFLEITIKDSEGKVWTNSMIAPAKDFSTGSVGYYVSEKMVNPESAERYQCSLSFTLIGSKPGKQ
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
46.0%
Kalotermitidae
26.0%
Unclassified
14.0%
Termopsidae
8.0%
Rhinotermitidae
6.0%
Taxonomy
Archaea
0
Bacteria
124
Eukaryota
0
Viruses
0
Unclassified
26
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 2 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 3 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 4 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 5 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 6 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 7 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 8 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 9 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 10 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 11 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 12 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 13 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 14 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 17 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 18 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 19 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 22 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 23 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 24 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 25 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 26 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 27 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 28 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 29 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 30 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 31 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 34 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 35 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 36 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 39 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 40 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 41 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 42 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 43 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 44 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 45 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 48 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 49 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 50 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 51 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 52 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_118533 | 3300042612 | Bacteria | 6291 |
| 2 | Ga0466705_186745 | 3300042612 | Bacteria | 12796 |
| 3 | Ga0466716_510055 | 3300042605 | Bacteria | 2002 |
| 4 | Ga0466720_103105 | 3300042607 | Bacteria | 1367 |
| 5 | Ga0466722_043942 | 3300042609 | Bacteria | 19516 |
| 6 | Ga0466698_092527 | 3300042610 | Bacteria | 1012 |
| 7 | Ga0123357_10025828 | 3300009784 | Unclassified | 7928 |
| 8 | Ga0123357_10081875 | 3300009784 | Bacteria | 4241 |
| 9 | Ga0123353_10338699 | 3300010167 | Bacteria | 2273 |
| 10 | Ga0123353_12106886 | 3300010167 | Bacteria | 686 |
| 11 | Ga0123354_10453570 | 3300010882 | Bacteria | 1036 |
| 12 | Ga0123354_10897870 | 3300010882 | Bacteria | 582 |
| 13 | Ga0466696_070892 | 3300042596 | Bacteria | 6148 |
| 14 | Ga0466699_222550 | 3300042597 | Unclassified | 1253 |
| 15 | Ga0466699_353207 | 3300042597 | Bacteria | 1035 |
| 16 | JGI24702J35022_10085695 | 3300002462 | Bacteria | 1710 |
| 17 | JGI24702J35022_10378298 | 3300002462 | Unclassified | 851 |
| 18 | Ga0068302_10671357 | 3300005071 | Bacteria | 600 |
| 19 | Ga0466727_050769 | 3300042655 | Bacteria | 2430 |
| 20 | Ga0466727_192460 | 3300042655 | Bacteria | 1504 |
| 21 | Ga0466711_355744 | 3300042615 | Bacteria | 24186 |
| 22 | Ga0466715_073076 | 3300042616 | Bacteria | 7839 |
| 23 | Ga0466723_190975 | 3300042618 | Unclassified | 1618 |
| 24 | Ga0466723_229569 | 3300042618 | Bacteria | 135891 |
| 25 | Ga0466726_419741 | 3300042619 | Bacteria | 2139 |
| 26 | Ga0466728_083558 | 3300042620 | Bacteria | 1907 |
| 27 | Ga0466729_162989 | 3300042621 | Bacteria | 1059 |
| 28 | Ga0466697_061559 | 3300042611 | Bacteria | 1177 |
| 29 | Ga0466705_051447 | 3300042612 | Bacteria | 1447 |
| 30 | Ga0466705_199821 | 3300042612 | Bacteria | 20106 |
| 31 | Ga0466719_238642 | 3300042606 | Bacteria | 27025 |
| 32 | Ga0466719_542426 | 3300042606 | Bacteria | 1211 |
| 33 | Ga0466722_222457 | 3300042609 | Bacteria | 1179 |
| 34 | Ga0123355_10032135 | 3300009826 | Bacteria | 8519 |
| 35 | Ga0264413_140583 | 3300024493 | Unclassified | 3157 |
| 36 | Ga0466694_056371 | 3300042594 | Bacteria | 2954 |
| 37 | JGI24698J34947_10025954 | 3300002449 | Bacteria | 3115 |
| 38 | JGI24705J35276_12143282 | 3300002504 | Bacteria | 1150 |
| 39 | Ga0466735_186720 | 3300042624 | Bacteria | 1466 |
| 40 | Ga0466704_238025 | 3300042643 | Bacteria | 4917 |
| 41 | Ga0466708_293069 | 3300042652 | Bacteria | 1383 |
| 42 | Ga0466711_045419 | 3300042615 | Bacteria | 7281 |
| 43 | Ga0466707_213828 | 3300042601 | Bacteria | 1207 |
| 44 | Ga0466719_115716 | 3300042606 | Bacteria | 12559 |
| 45 | Ga0123356_11727659 | 3300010049 | Bacteria | 777 |
| 46 | Ga0123356_12193270 | 3300010049 | Bacteria | 690 |
| 47 | Ga0123353_10191992 | 3300010167 | Bacteria | 3223 |
| 48 | Ga0123353_10257601 | 3300010167 | Bacteria | 2697 |
| 49 | Ga0123353_11071658 | 3300010167 | Bacteria | 1074 |
| 50 | Ga0123353_12055994 | 3300010167 | Bacteria | 697 |
| 51 | Ga0123353_12124412 | 3300010167 | Bacteria | 683 |
| 52 | Ga0264413_113558 | 3300024493 | Bacteria | 10002 |
| 53 | Ga0466691_223008 | 3300042593 | Bacteria | 3924 |
| 54 | Ga0466694_089873 | 3300042594 | Unclassified | 1405 |
| 55 | JGI24695J34938_10358368 | 3300002450 | Bacteria | 642 |
| 56 | Ga0466715_523283 | 3300042616 | Bacteria | 1891 |
| 57 | Ga0466726_152317 | 3300042619 | Bacteria | 1034 |
| 58 | Ga0466726_163245 | 3300042619 | Bacteria | 7550 |
| 59 | Ga0466726_203667 | 3300042619 | Unclassified | 1542 |
| 60 | Ga0466705_246688 | 3300042612 | Unclassified | 1046 |
| 61 | Ga0466732_142097 | 3300042656 | Bacteria | 2689 |
| 62 | Ga0466700_067861 | 3300042600 | Unclassified | 1691 |
| 63 | Ga0466719_042847 | 3300042606 | Bacteria | 2644 |
| 64 | Ga0123357_10502711 | 3300009784 | Bacteria | 1005 |
| 65 | Ga0123355_10061960 | 3300009826 | Bacteria | 6039 |
| 66 | Ga0123356_11240093 | 3300010049 | Bacteria | 911 |
| 67 | Ga0123354_10212389 | 3300010882 | Unclassified | 2086 |
| 68 | Ga0264413_114933 | 3300024493 | Unclassified | 3872 |
| 69 | Ga0466692_004525 | 3300042591 | Bacteria | 19839 |
| 70 | Ga0466694_346979 | 3300042594 | Bacteria | 2642 |
| 71 | Ga0466703_083220 | 3300042636 | Bacteria | 11626 |
| 72 | Ga0466727_211942 | 3300042655 | Bacteria | 3846 |
| 73 | Ga0466723_204621 | 3300042618 | Bacteria | 3050 |
| 74 | Ga0466726_233470 | 3300042619 | Bacteria | 1003 |
| 75 | Ga0466705_236704 | 3300042612 | Bacteria | 3055 |
| 76 | Ga0466707_001459 | 3300042601 | Bacteria | 1833 |
| 77 | Ga0123356_11696182 | 3300010049 | Bacteria | 784 |
| 78 | Ga0123353_10809068 | 3300010167 | Bacteria | 1292 |
| 79 | Ga0123354_10207177 | 3300010882 | Unclassified | 2133 |
| 80 | Ga0466690_357328 | 3300042590 | Bacteria | 3087 |
| 81 | Ga0466712_011615 | 3300042614 | Bacteria | 17188 |
| 82 | Ga0466712_016258 | 3300042614 | Unclassified | 1408 |
| 83 | Ga0466701_066056 | 3300042598 | Bacteria | 1338 |
| 84 | Ga0466700_149378 | 3300042600 | Bacteria | 3599 |
| 85 | Ga0466720_029946 | 3300042607 | Bacteria | 2731 |
| 86 | Ga0123357_10074582 | 3300009784 | Bacteria | 4487 |
| 87 | Ga0123356_10378329 | 3300010049 | Bacteria | 1548 |
| 88 | Ga0123356_13765690 | 3300010049 | Bacteria | 524 |
| 89 | Ga0123353_10970984 | 3300010167 | Bacteria | 1146 |
| 90 | Ga0264413_110424 | 3300024493 | Bacteria | 8179 |
| 91 | Ga0415639_066529 | 3300038395 | Bacteria | 1471 |
| 92 | Ga0466691_058588 | 3300042593 | Unclassified | 2583 |
| 93 | Ga0466691_179449 | 3300042593 | Bacteria | 11699 |
| 94 | JGI24698J34947_10005072 | 3300002449 | Bacteria | 7212 |
| 95 | JGI24705J35276_12134309 | 3300002504 | Bacteria | 1116 |
| 96 | JGI24705J35276_12215674 | 3300002504 | Bacteria | 2012 |
| 97 | JGI24696J40584_12924621 | 3300002834 | Bacteria | 1390 |
| 98 | Ga0466735_138567 | 3300042624 | Bacteria | 1254 |
| 99 | Ga0466703_208720 | 3300042636 | Bacteria | 25237 |
| 100 | Ga0466704_048699 | 3300042643 | Bacteria | 1975 |
| 101 | Ga0466727_114088 | 3300042655 | Unclassified | 2987 |
| 102 | Ga0466718_168109 | 3300042617 | Bacteria | 1849 |
| 103 | Ga0466723_373653 | 3300042618 | Bacteria | 3164 |
| 104 | Ga0466728_015194 | 3300042620 | Bacteria | 7881 |
| 105 | Ga0466700_078807 | 3300042600 | Unclassified | 1040 |
| 106 | Ga0466707_402129 | 3300042601 | Bacteria | 1290 |
| 107 | Ga0466720_007829 | 3300042607 | Bacteria | 3194 |
| 108 | Ga0123353_11570671 | 3300010167 | Bacteria | 833 |
| 109 | Ga0123354_10008550 | 3300010882 | Bacteria | 15576 |
| 110 | Ga0466693_276539 | 3300042592 | Bacteria | 2753 |
| 111 | Ga0466699_129794 | 3300042597 | Unclassified | 1288 |
| 112 | JGI24702J35022_10014937 | 3300002462 | Bacteria | 4278 |
| 113 | JGI24702J35022_10340509 | 3300002462 | Bacteria | 894 |
| 114 | JGI24705J35276_12116765 | 3300002504 | Unclassified | 1060 |
| 115 | Ga0068302_10034339 | 3300005071 | Bacteria | 2030 |
| 116 | Ga0466704_378761 | 3300042643 | Bacteria | 3781 |
| 117 | Ga0466705_518498 | 3300042612 | Bacteria | 4981 |
| 118 | Ga0466715_196864 | 3300042616 | Bacteria | 2681 |
| 119 | Ga0466723_120943 | 3300042618 | Unclassified | 2233 |
| 120 | Ga0466723_125555 | 3300042618 | Bacteria | 5365 |
| 121 | Ga0466733_041582 | 3300042659 | Bacteria | 3084 |
| 122 | Ga0466707_171751 | 3300042601 | Bacteria | 6648 |
| 123 | Ga0466716_163127 | 3300042605 | Bacteria | 5024 |
| 124 | Ga0466719_442691 | 3300042606 | Bacteria | 1869 |
| 125 | Ga0466719_509493 | 3300042606 | Unclassified | 2898 |
| 126 | Ga0123357_10962657 | 3300009784 | Bacteria | 538 |
| 127 | Ga0123356_11244299 | 3300010049 | Unclassified | 909 |
| 128 | Ga0123353_11057313 | 3300010167 | Bacteria | 1083 |
| 129 | Ga0123353_12147155 | 3300010167 | Bacteria | 678 |
| 130 | Ga0264413_113473 | 3300024493 | Bacteria | 1515 |
| 131 | Ga0264413_124420 | 3300024493 | Unclassified | 3511 |
| 132 | Ga0415639_003598 | 3300038395 | Unclassified | 2502 |
| 133 | Ga0466692_181646 | 3300042591 | Unclassified | 2217 |
| 134 | Ga0466691_185377 | 3300042593 | Bacteria | 2468 |
| 135 | Ga0466694_065844 | 3300042594 | Bacteria | 25000 |
| 136 | FAAS_10759194 | 3300001880 | Bacteria | 560 |
| 137 | Ga0466704_077703 | 3300042643 | Bacteria | 6352 |
| 138 | Ga0466704_231549 | 3300042643 | Bacteria | 11125 |
| 139 | Ga0466727_066094 | 3300042655 | Bacteria | 3523 |
| 140 | Ga0466715_020945 | 3300042616 | Bacteria | 11382 |
| 141 | Ga0466715_076935 | 3300042616 | Unclassified | 12690 |
| 142 | Ga0466723_087073 | 3300042618 | Unclassified | 3843 |
| 143 | Ga0466723_257824 | 3300042618 | Bacteria | 8715 |
| 144 | Ga0466726_200206 | 3300042619 | Bacteria | 10689 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.