Protein Family IF07071

Metagenome
113 Members
23 Samples
109 Scaffolds
159.4 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_061471|Ga0466705_061471_2178_2759
Length
193 aa
Sequence
VVPERSLGGSLKFKGKRNVGRYGRCGARRREERKMALTSYLKVTGKSQGEIKGDCPQGGDKKDRILVYAVDHAVEIPRDTHTGLPTGQRIHKPLVITKHKDQASPLLFRACTTGENVDLTLDFYRIKPDGTEEKYFSVSVEEGIVVDMREYTPETFLADNKPYFDMEQVSFTYSRITWTYNDGNIEYTDDWKA

📊 Sample Types

Isolate 0.0%
Metagenome 100.0%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 56.5%
Rhinotermitidae 8.7%
Termopsidae 8.7%
Unclassified 8.7%
Termitidae 8.7%
Hodotermitidae 4.3%
Passalidae 4.3%

🌳 Taxonomy

Archaea 0
Bacteria 104
Eukaryota 0
Viruses 0
Unclassified 9

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
3 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
4 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
5 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
6 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
7 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
8 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
9 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
10 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
11 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
12 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
13 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
14 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
15 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
21 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
22 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
23 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466692_119425 3300042591 Bacteria 6957
2 Ga0466713_121508 3300042602 Bacteria 17512
3 Ga0466716_109443 3300042605 Bacteria 4281
4 Ga0466716_372240 3300042605 Bacteria 3212
5 Ga0466716_387464 3300042605 Bacteria 1194
6 2227219678 2225789004 Bacteria 33509
7 Ga0068302_10096374 3300005071 Bacteria 1837
8 Ga0466702_052977 3300042635 Bacteria 2273
9 Ga0466703_385228 3300042636 Bacteria 2487
10 Ga0466704_480324 3300042643 Bacteria 57822
11 Ga0466709_003805 3300042648 Unclassified 1085
12 Ga0466709_379843 3300042648 Bacteria 6036
13 Ga0466708_115442 3300042652 Bacteria 26831
14 Ga0466711_357386 3300042615 Bacteria 43213
15 Ga0466723_040186 3300042618 Bacteria 7112
16 Ga0466723_135767 3300042618 Bacteria 5999
17 Ga0466723_225778 3300042618 Bacteria 27431
18 Ga0466705_167329 3300042612 Bacteria 6458
19 Ga0466719_150909 3300042606 Unclassified 1049
20 2227485557 2225789004 Bacteria 821
21 Ga0466704_310121 3300042643 Bacteria 3837
22 Ga0466705_393172 3300042612 Bacteria 14206
23 Ga0466705_406559 3300042612 Bacteria 1388
24 Ga0466705_434869 3300042612 Bacteria 17883
25 Ga0466711_065690 3300042615 Bacteria 55296
26 Ga0466711_145003 3300042615 Bacteria 32111
27 Ga0466711_357985 3300042615 Bacteria 9184
28 Ga0466715_438401 3300042616 Bacteria 6437
29 Ga0466723_190294 3300042618 Bacteria 2963
30 Ga0466728_188644 3300042620 Bacteria 6212
31 Ga0466705_037480 3300042612 Bacteria 16260
32 Ga0466705_073359 3300042612 Bacteria 3762
33 Ga0466707_312784 3300042601 Bacteria 2122
34 Ga0466716_192120 3300042605 Unclassified 2768
35 Ga0466719_248793 3300042606 Bacteria 1204
36 Ga0466719_378663 3300042606 Bacteria 3471
37 Ga0466735_023963 3300042624 Bacteria 2832
38 Ga0466735_212347 3300042624 Bacteria 1245
39 Ga0466703_086225 3300042636 Bacteria 4068
40 Ga0466704_098248 3300042643 Bacteria 43812
41 Ga0466704_181596 3300042643 Bacteria 1056
42 Ga0466704_556468 3300042643 Unclassified 1067
43 Ga0466709_347030 3300042648 Bacteria 4072
44 Ga0466705_532274 3300042612 Bacteria 3468
45 Ga0466728_477432 3300042620 Bacteria 1197
46 Ga0466705_048311 3300042612 Unclassified 17729
47 Ga0466705_238344 3300042612 Unclassified 11844
48 Ga0415639_029734 3300038395 Bacteria 4420
49 Ga0466707_114918 3300042601 Bacteria 13437
50 Ga0466719_522070 3300042606 Bacteria 8468
51 Ga0466735_046358 3300042624 Bacteria 1824
52 Ga0466735_107626 3300042624 Bacteria 1093
53 Ga0466703_338509 3300042636 Bacteria 1025
54 Ga0466703_419789 3300042636 Bacteria 3521
55 Ga0466709_364708 3300042648 Bacteria 6209
56 Ga0466708_073923 3300042652 Bacteria 28239
57 Ga0466708_127414 3300042652 Bacteria 4381
58 Ga0466708_356086 3300042652 Bacteria 11401
59 Ga0466715_251341 3300042616 Bacteria 28845
60 Ga0466705_072790 3300042612 Bacteria 38485
61 Ga0466705_204879 3300042612 Bacteria 8276
62 Ga0466691_021121 3300042593 Bacteria 1089
63 Ga0466706_018690 3300042599 Bacteria 6303
64 Ga0466716_486684 3300042605 Bacteria 9713
65 Ga0466719_048277 3300042606 Bacteria 3502
66 Ga0466719_227482 3300042606 Bacteria 8521
67 Ga0466719_316892 3300042606 Bacteria 2109
68 Ga0466703_057784 3300042636 Bacteria 5993
69 Ga0466709_003623 3300042648 Bacteria 1975
70 Ga0466708_059363 3300042652 Bacteria 2375
71 Ga0466715_225282 3300042616 Bacteria 6063
72 Ga0466723_084060 3300042618 Unclassified 1284
73 Ga0466723_301572 3300042618 Bacteria 6168
74 Ga0466728_391658 3300042620 Bacteria 3233
75 Ga0466729_002492 3300042621 Bacteria 3086
76 Ga0466691_178607 3300042593 Bacteria 2607
77 Ga0466691_192302 3300042593 Bacteria 17081
78 Ga0466716_118615 3300042605 Bacteria 4398
79 Ga0466716_397000 3300042605 Bacteria 2397
80 Ga0466716_472834 3300042605 Bacteria 4843
81 Ga0466719_038044 3300042606 Bacteria 1522
82 Ga0466719_213670 3300042606 Unclassified 2492
83 Ga0466719_491424 3300042606 Bacteria 10556
84 Ga0466709_406160 3300042648 Bacteria 4816
85 Ga0466715_101870 3300042616 Bacteria 37384
86 Ga0466705_029122 3300042612 Bacteria 20880
87 Ga0466705_146705 3300042612 Bacteria 30978
88 Ga0466713_072923 3300042602 Bacteria 35230
89 Ga0466716_124713 3300042605 Bacteria 1552
90 Ga0466735_204341 3300042624 Bacteria 2257
91 Ga0466703_349678 3300042636 Bacteria 1476
92 Ga0466708_170705 3300042652 Bacteria 2291
93 Ga0466705_450720 3300042612 Bacteria 30343
94 Ga0466715_510703 3300042616 Bacteria 1263
95 Ga0466723_267445 3300042618 Bacteria 9705
96 Ga0466729_032206 3300042621 Bacteria 2206
97 Ga0466705_008517 3300042612 Bacteria 2716
98 Ga0466705_061471 3300042612 Bacteria 46761
99 Ga0466690_302658 3300042590 Bacteria 1111
100 Ga0466716_179001 3300042605 Bacteria 9924
101 Ga0466716_454502 3300042605 Bacteria 4219
102 Ga0466704_034559 3300042643 Bacteria 22114
103 Ga0466704_587183 3300042643 Unclassified 1321
104 Ga0466709_105100 3300042648 Bacteria 3313
105 Ga0466708_115142 3300042652 Bacteria 15254
106 Ga0466711_387948 3300042615 Bacteria 10126
107 Ga0466711_453387 3300042615 Bacteria 7157
108 Ga0466715_013852 3300042616 Bacteria 14203
109 Ga0466728_129816 3300042620 Bacteria 20652

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 2225789004 2227219678 2227651731 159
2 2225789004 2227485557 2227951070 159
3 3300038395 Ga0415639_029734 Ga0415639_029734_114_593 159
4 3300042590 Ga0466690_302658 Ga0466690_302658_405_884 159
5 3300042591 Ga0466692_119425 Ga0466692_119425_1310_1789 159
6 3300042593 Ga0466691_021121 Ga0466691_021121_36_515 159
7 3300042593 Ga0466691_178607 Ga0466691_178607_1531_2010 159
8 3300042593 Ga0466691_192302 Ga0466691_192302_4958_5437 159
9 3300042599 Ga0466706_018690 Ga0466706_018690_2914_3393 159
10 3300042601 Ga0466707_114918 Ga0466707_114918_7904_8383 159
11 3300042601 Ga0466707_312784 Ga0466707_312784_654_1133 159
12 3300042602 Ga0466713_072923 Ga0466713_072923_9792_10271 159
13 3300042602 Ga0466713_121508 Ga0466713_121508_3430_3909 159
14 3300042605 Ga0466716_109443 Ga0466716_109443_2491_2970 159
15 3300042605 Ga0466716_118615 Ga0466716_118615_1466_1945 159
16 3300042605 Ga0466716_124713 Ga0466716_124713_79_558 159
17 3300042605 Ga0466716_179001 Ga0466716_179001_6638_7117 159
18 3300042605 Ga0466716_192120 Ga0466716_192120_462_941 159
19 3300042605 Ga0466716_372240 Ga0466716_372240_2561_3040 159
20 3300042605 Ga0466716_387464 Ga0466716_387464_210_689 159
21 3300042605 Ga0466716_397000 Ga0466716_397000_1610_2089 159
22 3300042605 Ga0466716_454502 Ga0466716_454502_765_1244 159
23 3300042605 Ga0466716_472834 Ga0466716_472834_543_1022 159
24 3300042605 Ga0466716_486684 Ga0466716_486684_4439_4918 159
25 3300042606 Ga0466719_038044 Ga0466719_038044_811_1290 159
26 3300042606 Ga0466719_048277 Ga0466719_048277_84_563 159
27 3300042606 Ga0466719_150909 Ga0466719_150909_149_628 159
28 3300042606 Ga0466719_213670 Ga0466719_213670_968_1447 159
29 3300042606 Ga0466719_227482 Ga0466719_227482_3075_3554 159
30 3300042606 Ga0466719_248793 Ga0466719_248793_308_787 159
31 3300042606 Ga0466719_316892 Ga0466719_316892_342_821 159
32 3300042606 Ga0466719_378663 Ga0466719_378663_942_1421 159
33 3300042606 Ga0466719_491424 Ga0466719_491424_3044_3523 159
34 3300042606 Ga0466719_522070 Ga0466719_522070_7639_8118 159
35 3300042612 Ga0466705_008517 Ga0466705_008517_1343_1822 159
36 3300042612 Ga0466705_008517 Ga0466705_008517_711_1190 159
37 3300042612 Ga0466705_029122 Ga0466705_029122_547_1026 159
38 3300042612 Ga0466705_048311 Ga0466705_048311_1929_2408 159
39 3300042612 Ga0466705_072790 Ga0466705_072790_23813_24292 159
40 3300042612 Ga0466705_073359 Ga0466705_073359_591_1070 159
41 3300042612 Ga0466705_146705 Ga0466705_146705_6531_7010 159
42 3300042612 Ga0466705_167329 Ga0466705_167329_1612_2091 159
43 3300042612 Ga0466705_204879 Ga0466705_204879_3476_3955 159
44 3300042612 Ga0466705_238344 Ga0466705_238344_6598_7077 159
45 3300042612 Ga0466705_393172 Ga0466705_393172_6728_7207 159
46 3300042612 Ga0466705_406559 Ga0466705_406559_375_854 159
47 3300042612 Ga0466705_434869 Ga0466705_434869_11130_11609 159
48 3300042612 Ga0466705_450720 Ga0466705_450720_5432_5911 159
49 3300042612 Ga0466705_450720 Ga0466705_450720_6211_6690 159
50 3300042612 Ga0466705_532274 Ga0466705_532274_2841_3320 159
51 3300042615 Ga0466711_065690 Ga0466711_065690_18367_18846 159
52 3300042615 Ga0466711_145003 Ga0466711_145003_8877_9356 159
53 3300042615 Ga0466711_357386 Ga0466711_357386_22023_22502 159
54 3300042615 Ga0466711_357985 Ga0466711_357985_1587_2066 159
55 3300042615 Ga0466711_387948 Ga0466711_387948_661_1140 159
56 3300042615 Ga0466711_453387 Ga0466711_453387_308_787 159
57 3300042616 Ga0466715_013852 Ga0466715_013852_8820_9299 159
58 3300042616 Ga0466715_101870 Ga0466715_101870_6350_6829 159
59 3300042616 Ga0466715_225282 Ga0466715_225282_2571_3050 159
60 3300042616 Ga0466715_251341 Ga0466715_251341_19268_19747 159
61 3300042616 Ga0466715_438401 Ga0466715_438401_2200_2679 159
62 3300042616 Ga0466715_510703 Ga0466715_510703_508_987 159
63 3300042618 Ga0466723_040186 Ga0466723_040186_33_512 159
64 3300042618 Ga0466723_040186 Ga0466723_040186_689_1168 159
65 3300042618 Ga0466723_084060 Ga0466723_084060_303_782 159
66 3300042618 Ga0466723_135767 Ga0466723_135767_4283_4762 159
67 3300042618 Ga0466723_190294 Ga0466723_190294_1278_1757 159
68 3300042618 Ga0466723_190294 Ga0466723_190294_2002_2481 159
69 3300042618 Ga0466723_225778 Ga0466723_225778_12583_13062 159
70 3300042618 Ga0466723_267445 Ga0466723_267445_5635_6114 159
71 3300042618 Ga0466723_301572 Ga0466723_301572_42_521 159
72 3300042620 Ga0466728_129816 Ga0466728_129816_3152_3631 159
73 3300042620 Ga0466728_188644 Ga0466728_188644_3528_4007 159
74 3300042620 Ga0466728_391658 Ga0466728_391658_18_497 159
75 3300042620 Ga0466728_477432 Ga0466728_477432_178_657 159
76 3300042621 Ga0466729_002492 Ga0466729_002492_2593_3072 159
77 3300042621 Ga0466729_032206 Ga0466729_032206_743_1222 159
78 3300042624 Ga0466735_023963 Ga0466735_023963_1213_1692 159
79 3300042624 Ga0466735_046358 Ga0466735_046358_658_1137 159
80 3300042624 Ga0466735_107626 Ga0466735_107626_304_783 159
81 3300042624 Ga0466735_204341 Ga0466735_204341_1751_2230 159
82 3300042624 Ga0466735_212347 Ga0466735_212347_405_884 159
83 3300042635 Ga0466702_052977 Ga0466702_052977_677_1156 159
84 3300042636 Ga0466703_057784 Ga0466703_057784_2908_3387 159
85 3300042636 Ga0466703_086225 Ga0466703_086225_2352_2831 159
86 3300042636 Ga0466703_338509 Ga0466703_338509_304_783 159
87 3300042636 Ga0466703_349678 Ga0466703_349678_777_1256 159
88 3300042636 Ga0466703_385228 Ga0466703_385228_472_951 159
89 3300042636 Ga0466703_419789 Ga0466703_419789_1711_2190 159
90 3300042643 Ga0466704_034559 Ga0466704_034559_4533_5012 159
91 3300042643 Ga0466704_098248 Ga0466704_098248_16933_17412 159
92 3300042643 Ga0466704_181596 Ga0466704_181596_257_736 159
93 3300042643 Ga0466704_310121 Ga0466704_310121_1852_2331 159
94 3300042643 Ga0466704_480324 Ga0466704_480324_2695_3174 159
95 3300042643 Ga0466704_556468 Ga0466704_556468_327_806 159
96 3300042643 Ga0466704_587183 Ga0466704_587183_451_930 159
97 3300042648 Ga0466709_003623 Ga0466709_003623_1201_1680 159
98 3300042648 Ga0466709_003805 Ga0466709_003805_53_532 159
99 3300042648 Ga0466709_105100 Ga0466709_105100_2451_2930 159
100 3300042648 Ga0466709_347030 Ga0466709_347030_984_1463 159
101 3300042648 Ga0466709_364708 Ga0466709_364708_161_640 159
102 3300042648 Ga0466709_379843 Ga0466709_379843_294_773 159
103 3300042648 Ga0466709_406160 Ga0466709_406160_2101_2580 159
104 3300042652 Ga0466708_059363 Ga0466708_059363_1825_2304 159
105 3300042652 Ga0466708_073923 Ga0466708_073923_23839_24318 159
106 3300042652 Ga0466708_115142 Ga0466708_115142_14488_14967 159
107 3300042652 Ga0466708_115442 Ga0466708_115442_6339_6818 159
108 3300042652 Ga0466708_127414 Ga0466708_127414_1558_2037 159
109 3300042652 Ga0466708_170705 Ga0466708_170705_1097_1576 159
110 3300042652 Ga0466708_356086 Ga0466708_356086_564_1043 159
111 3300005071 Ga0068302_10096374 Ga0068302_100963743 160
112 3300042612 Ga0466705_037480 Ga0466705_037480_2305_2814 169
113 3300042612 Ga0466705_061471 Ga0466705_061471_2178_2759 193

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05638 T6SS_HCP Type VI secretion system effector, Hcp 40 180 0.94

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.69 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.