Protein Family IF07041
Metagenome
Isolate
102
Members
32
Samples
99
Scaffolds
614.04
Avg Length
Representative Sequence
- ID
- 3300042612|Ga0466705_018354|Ga0466705_018354_878_2893
- Length
- 663 aa
- Sequence
- MVNSLDWAKMTIPAKLNIVGIVWYTCGEFSIEDLRKKVVRVSGSHIVDDSGRTLLLRGCNLGGGSKIPSIPXXXXLSGRPSEVSFAGRPFPLEEAEEHVGNLKRSGFGLVRLVITWEALEHSGPGIYDEAYLAYLRKLLLEAEKKDLRVIMDPHQDAWSRWTGGDGAPAWTLERLGFDLERLDAVGAAVTMERYAENHGGRAYPDMIWPVNYSLYGASTLFTLFFAGNAYAPGLTIEGESAQDWLQERYMACFRHCYRRLKNCKAIIGWEAMNEPHPGFIGCGDLNRTENRVVALGAVPSPWEAMAAASGKPVRAPVYIPWLKAPIKTGRALINPQGLSLFRPGFSCPWKVAGVWAGEGEDMRLLKKDHFALYQGRPARFNEDFLKPFMIRFFDRMREAGRPALFFVQGFPHGDPPSWSAAEGADVAHAFHCYDGPALFTKTFRPWITADEKTGRIILGRKNTAAFYSLRLKKMREWTRDKMGDMPCLLGEFGLPFDLNHRRACREKDPSKEDYRLHEEALSLYYDGIDENLLHAAIWNYTPGNTREEGDGWNGEDLSIYSGGKGRAMGGWLRPYPMATAGVPLFVRWDRRRAFFRYRFLADPAIEAPTEIYAPPEWLGPRPLLTVSEGLRGEYKEEERRIFVYNRGFEGEAEISAAPGAEEA
Sample Types
Isolate
2.9%
Metagenome
97.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
45.2%
Termitidae
22.6%
Rhinotermitidae
9.7%
Unclassified
9.7%
Termopsidae
9.7%
Blaberidae
3.2%
Taxonomy
Archaea
0
Bacteria
100
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 2 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 3 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 8 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 9 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 10 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 11 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 16 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 17 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 18 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 19 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 20 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 21 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 22 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 23 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 24 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 25 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 26 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 29 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 30 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 31 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 32 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466696_026596 | 3300042596 | Bacteria | 4998 |
| 2 | Ga0466723_034676 | 3300042618 | Bacteria | 12042 |
| 3 | Ga0466723_167081 | 3300042618 | Bacteria | 9309 |
| 4 | Ga0466716_068911 | 3300042605 | Bacteria | 9608 |
| 5 | Ga0466716_531175 | 3300042605 | Bacteria | 8586 |
| 6 | Ga0466704_057454 | 3300042643 | Bacteria | 3716 |
| 7 | Ga0466709_253311 | 3300042648 | Bacteria | 26545 |
| 8 | Ga0466709_276271 | 3300042648 | Bacteria | 18152 |
| 9 | Ga0466708_058470 | 3300042652 | Bacteria | 25784 |
| 10 | Ga0466708_211329 | 3300042652 | Bacteria | 8406 |
| 11 | Ga0466708_340529 | 3300042652 | Bacteria | 19441 |
| 12 | Ga0466708_408364 | 3300042652 | Bacteria | 2054 |
| 13 | Ga0466705_018354 | 3300042612 | Bacteria | 3192 |
| 14 | Ga0456237_0004236 | 3300041968 | Bacteria | 2308 |
| 15 | Ga0456237_0004309 | 3300041968 | Bacteria | 2291 |
| 16 | Ga0466690_178367 | 3300042590 | Bacteria | 11010 |
| 17 | Ga0466691_143751 | 3300042593 | Bacteria | 3368 |
| 18 | Ga0466705_470076 | 3300042612 | Bacteria | 13798 |
| 19 | Ga0466723_246723 | 3300042618 | Bacteria | 18930 |
| 20 | Ga0123357_10027284 | 3300009784 | Bacteria | 7717 |
| 21 | Ga0123357_10056446 | 3300009784 | Bacteria | 5281 |
| 22 | Ga0123353_10119423 | 3300010167 | Bacteria | 4240 |
| 23 | Ga0466708_372461 | 3300042652 | Bacteria | 2374 |
| 24 | Ga0466690_153744 | 3300042590 | Bacteria | 2210 |
| 25 | Ga0466690_414879 | 3300042590 | Bacteria | 4604 |
| 26 | Ga0466691_000965 | 3300042593 | Bacteria | 5152 |
| 27 | Ga0466694_247086 | 3300042594 | Bacteria | 13485 |
| 28 | Ga0466705_448849 | 3300042612 | Bacteria | 4685 |
| 29 | Ga0466711_109991 | 3300042615 | Bacteria | 6783 |
| 30 | Ga0466723_063907 | 3300042618 | Bacteria | 13522 |
| 31 | Ga0466723_097574 | 3300042618 | Bacteria | 6304 |
| 32 | Ga0466723_260262 | 3300042618 | Bacteria | 3773 |
| 33 | Ga0466723_268309 | 3300042618 | Bacteria | 19008 |
| 34 | Ga0123353_10264459 | 3300010167 | Bacteria | 2654 |
| 35 | Ga0466722_110914 | 3300042609 | Bacteria | 2536 |
| 36 | Ga0466709_203661 | 3300042648 | Bacteria | 13991 |
| 37 | Ga0466708_166006 | 3300042652 | Bacteria | 9987 |
| 38 | Ga0466690_248419 | 3300042590 | Bacteria | 4547 |
| 39 | Ga0466695_351978 | 3300042595 | Bacteria | 4749 |
| 40 | Ga0466711_299825 | 3300042615 | Bacteria | 33971 |
| 41 | Ga0466715_222242 | 3300042616 | Bacteria | 16254 |
| 42 | Ga0466723_225852 | 3300042618 | Bacteria | 63792 |
| 43 | Ga0466728_071487 | 3300042620 | Bacteria | 17488 |
| 44 | Ga0123353_10027951 | 3300010167 | Bacteria | 8654 |
| 45 | Ga0123354_10139780 | 3300010882 | Bacteria | 3003 |
| 46 | Ga0466707_084962 | 3300042601 | Bacteria | 3158 |
| 47 | Ga0466719_137690 | 3300042606 | Bacteria | 11186 |
| 48 | Ga0466735_004662 | 3300042624 | Bacteria | 7046 |
| 49 | Ga0466692_069432 | 3300042591 | Unclassified | 2961 |
| 50 | Ga0466691_027630 | 3300042593 | Bacteria | 8459 |
| 51 | Ga0466696_014251 | 3300042596 | Bacteria | 20610 |
| 52 | Ga0072941_1011693 | 3300005201 | Bacteria | 17691 |
| 53 | Ga0466711_384782 | 3300042615 | Bacteria | 24719 |
| 54 | Ga0466715_017954 | 3300042616 | Bacteria | 6763 |
| 55 | Ga0466716_232778 | 3300042605 | Bacteria | 6036 |
| 56 | Ga0466719_374938 | 3300042606 | Bacteria | 5233 |
| 57 | Ga0466703_020542 | 3300042636 | Bacteria | 11111 |
| 58 | Ga0466708_009540 | 3300042652 | Bacteria | 24875 |
| 59 | Ga0466705_110584 | 3300042612 | Bacteria | 16648 |
| 60 | Ga0415639_002007 | 3300038395 | Bacteria | 2554 |
| 61 | Ga0466711_051829 | 3300042615 | Bacteria | 36835 |
| 62 | Ga0466728_070857 | 3300042620 | Bacteria | 7125 |
| 63 | Ga0466716_266025 | 3300042605 | Bacteria | 13871 |
| 64 | Ga0466719_304178 | 3300042606 | Bacteria | 4909 |
| 65 | Ga0466719_304455 | 3300042606 | Bacteria | 13742 |
| 66 | Ga0466735_081516 | 3300042624 | Bacteria | 2763 |
| 67 | Ga0466703_045567 | 3300042636 | Bacteria | 7609 |
| 68 | Ga0466703_223272 | 3300042636 | Bacteria | 9193 |
| 69 | Ga0466690_180157 | 3300042590 | Bacteria | 5143 |
| 70 | Ga0466691_058682 | 3300042593 | Bacteria | 20237 |
| 71 | Ga0466691_218029 | 3300042593 | Bacteria | 2278 |
| 72 | Ga0466694_098051 | 3300042594 | Bacteria | 2900 |
| 73 | Ga0466696_083152 | 3300042596 | Bacteria | 12112 |
| 74 | Ga0466705_390490 | 3300042612 | Bacteria | 10345 |
| 75 | Ga0466715_097689 | 3300042616 | Bacteria | 10316 |
| 76 | Ga0466715_211874 | 3300042616 | Bacteria | 8631 |
| 77 | Ga0466723_207065 | 3300042618 | Bacteria | 8470 |
| 78 | Ga0466707_102298 | 3300042601 | Bacteria | 8981 |
| 79 | Ga0466719_253447 | 3300042606 | Bacteria | 4787 |
| 80 | Ga0466703_140054 | 3300042636 | Bacteria | 14116 |
| 81 | Ga0466704_075784 | 3300042643 | Bacteria | 14543 |
| 82 | Ga0466704_099679 | 3300042643 | Bacteria | 21380 |
| 83 | Ga0466709_177802 | 3300042648 | Bacteria | 13165 |
| 84 | Ga0466727_219398 | 3300042655 | Bacteria | 3268 |
| 85 | Ga0466705_187456 | 3300042612 | Unclassified | 4758 |
| 86 | Ga0466705_341176 | 3300042612 | Bacteria | 9923 |
| 87 | Ga0466733_222460 | 3300042659 | Bacteria | 1944 |
| 88 | Ga0466691_064683 | 3300042593 | Bacteria | 17448 |
| 89 | Ga0466694_149074 | 3300042594 | Bacteria | 12615 |
| 90 | Ga0466711_085379 | 3300042615 | Bacteria | 2090 |
| 91 | Ga0466715_010139 | 3300042616 | Bacteria | 16775 |
| 92 | Ga0466715_045338 | 3300042616 | Bacteria | 3243 |
| 93 | Ga0466726_332717 | 3300042619 | Bacteria | 8555 |
| 94 | Ga0123357_10146385 | 3300009784 | Bacteria | 2884 |
| 95 | Ga0466716_131232 | 3300042605 | Bacteria | 7467 |
| 96 | Ga0466716_150573 | 3300042605 | Bacteria | 10096 |
| 97 | Ga0466703_326844 | 3300042636 | Bacteria | 8617 |
| 98 | Ga0466704_107222 | 3300042643 | Bacteria | 19502 |
| 99 | Ga0466704_606958 | 3300042643 | Bacteria | 82552 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.