Protein Family IF07034

Metagenome Isolate
112 Members
40 Samples
106 Scaffolds
327.96 Avg Length

🧬 Representative Sequence

ID
3300042612|Ga0466705_007712|Ga0466705_007712_4242_5333
Length
363 aa
Sequence
VLKNRLRKAAAAIRIYVYRFRIVHTPDRFVTRIGGNRMRVFSGVQPTGNIHIGNYLGALRQFVELQDENECVYCIVDMHAVTVPKDAALLRENILDVAALYMAVGIDPKKSIVFVQSDVPGHAELTWILMCNTYTGELSRMTQFKEKSRGNESAPAGLFTYPVLMAADILLYDSDVVPVGSDQKQHIEICRDIAIRVNNRYGEVFVIPEGRFLKEGARIMSLDDPGSKMSKSAENPLSRISLLDDEAKIRKSVMKATTDSDGVIRFDAENKPGVSNLLNIYSAFSGMRIPDIEKKYEGAGYGTFKKELAELTVDALAPIRKSYEEIRRSEELPAALRNGAERANAISERTMARVKDFFGLGVK

📊 Sample Types

Isolate 5.4%
Metagenome 94.6%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 35.0%
Termitidae 27.5%
Unclassified 17.5%
Rhinotermitidae 7.5%
Termopsidae 5.0%
Blattidae 2.5%
Passalidae 2.5%
Hodotermitidae 2.5%

🌳 Taxonomy

Archaea 0
Bacteria 109
Eukaryota 0
Viruses 0
Unclassified 3

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2940228231 Anaerovoracaceae bacterium PM5-7 Isolate Blattidae
2 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
3 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
4 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
5 3300042582 Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 Metagenome Termitidae
6 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
10 2820234266 Unclassified Firmicutes Th196P3bin99 Isolate Unclassified
11 2820412446 Unclassified Firmicutes Lab288P4bin39 Isolate Unclassified
12 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
13 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
14 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
15 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
16 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
17 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
18 2820593525 Unclassified Firmicutes Emb289P1bin7 Isolate Unclassified
19 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
20 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
21 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
24 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
25 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
26 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
27 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
28 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
29 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
30 3300009784 Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 Metagenome Termitidae
31 2225789004 Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) Metagenome Passalidae
32 2820314258 Unclassified Firmicutes Nt197P4bin16 Isolate Unclassified
33 2820357977 Unclassified Firmicutes Nt197P3bin136 Isolate Unclassified
34 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
35 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
36 3300010882 Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 Metagenome Termitidae
37 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
38 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
39 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
40 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466705_007712 3300042612 Bacteria 13270
2 Ga0466705_322946 3300042612 Bacteria 2227
3 Ga0466733_067471 3300042659 Bacteria 1229
4 JGI24702J35022_10011976 3300002462 Bacteria 4830
5 Ga0466704_609108 3300042643 Bacteria 5526
6 Ga0466708_020469 3300042652 Bacteria 6680
7 Ga0466690_132802 3300042590 Bacteria 1235
8 Ga0466692_025231 3300042591 Bacteria 8510
9 Ga0466691_041561 3300042593 Bacteria 1229
10 Ga0466707_013324 3300042601 Bacteria 4287
11 Ga0466707_051722 3300042601 Bacteria 4262
12 Ga0466707_226499 3300042601 Bacteria 1876
13 Ga0466707_259060 3300042601 Bacteria 63426
14 Ga0466707_323369 3300042601 Bacteria 4346
15 Ga0123356_10006763 3300010049 Bacteria 11541
16 Ga0123356_10016982 3300010049 Bacteria 6931
17 Ga0123354_10001693 3300010882 Bacteria 27584
18 Ga0123354_10042951 3300010882 Bacteria 6959
19 Ga0123354_10100343 3300010882 Bacteria 3918
20 Ga0466711_319958 3300042615 Bacteria 6334
21 Ga0466715_288361 3300042616 Bacteria 5019
22 Ga0466728_281052 3300042620 Unclassified 4868
23 Ga0466697_244524 3300042611 Bacteria 2469
24 Ga0466704_092524 3300042643 Bacteria 8412
25 Ga0466709_341436 3300042648 Bacteria 1721
26 Ga0466691_143017 3300042593 Bacteria 2078
27 Ga0466707_147838 3300042601 Bacteria 4922
28 Ga0466707_201034 3300042601 Bacteria 25605
29 Ga0466705_513740 3300042612 Bacteria 5564
30 Ga0466723_158643 3300042618 Bacteria 15110
31 Ga0466702_315269 3300042635 Bacteria 1195
32 Ga0466703_087482 3300042636 Bacteria 11765
33 Ga0466708_019882 3300042652 Bacteria 11664
34 Ga0466727_306941 3300042655 Bacteria 4706
35 Ga0466713_044186 3300042602 Bacteria 91853
36 Ga0123353_10012557 3300010167 Bacteria 12055
37 Ga0123353_10034424 3300010167 Unclassified 7905
38 Ga0123353_10034812 3300010167 Bacteria 7869
39 Ga0123353_10280386 3300010167 Bacteria 2560
40 Ga0123353_10928472 3300010167 Bacteria 1180
41 Ga0466733_121195 3300042659 Bacteria 1831
42 2227469385 2225789004 Bacteria 4962
43 Ga0466703_091611 3300042636 Bacteria 8702
44 Ga0466703_279509 3300042636 Bacteria 2648
45 Ga0466704_234403 3300042643 Bacteria 9832
46 Ga0466704_600801 3300042643 Bacteria 3103
47 Ga0466696_335622 3300042596 Bacteria 1175
48 Ga0466706_075594 3300042599 Bacteria 269977
49 Ga0466700_348908 3300042600 Bacteria 3186
50 Ga0466707_061153 3300042601 Bacteria 4088
51 Ga0123353_10030271 3300010167 Bacteria 8363
52 Ga0123353_10098134 3300010167 Bacteria 4722
53 Ga0123353_10114421 3300010167 Bacteria 4343
54 Ga0466726_467723 3300042619 Bacteria 12504
55 Ga0466729_077554 3300042621 Bacteria 10202
56 Ga0466705_277411 3300042612 Bacteria 10557
57 JGI24705J35276_12237829 3300002504 Bacteria 13426
58 Ga0466704_206743 3300042643 Bacteria 8638
59 Ga0466708_192881 3300042652 Bacteria 26557
60 Ga0466707_267681 3300042601 Bacteria 14420
61 Ga0466719_023879 3300042606 Bacteria 33964
62 Ga0123356_10226003 3300010049 Bacteria 1932
63 Ga0466711_409991 3300042615 Bacteria 4050
64 Ga0466715_474526 3300042616 Bacteria 10443
65 Ga0466726_362256 3300042619 Bacteria 14672
66 Ga0466703_338746 3300042636 Bacteria 1406
67 Ga0466727_059909 3300042655 Bacteria 10245
68 Ga0466696_410622 3300042596 Bacteria 11047
69 Ga0466707_084982 3300042601 Bacteria 1885
70 Ga0466707_142147 3300042601 Unclassified 8761
71 Ga0466707_352936 3300042601 Bacteria 2406
72 Ga0466713_026803 3300042602 Bacteria 64874
73 Ga0123353_10075075 3300010167 Bacteria 5434
74 Ga0123353_10182065 3300010167 Bacteria 3325
75 Ga0123353_10202746 3300010167 Bacteria 3119
76 Ga0466715_452243 3300042616 Bacteria 11970
77 Ga0466728_273349 3300042620 Bacteria 18581
78 Ga0466729_033681 3300042621 Bacteria 4510
79 JGI24702J35022_10036370 3300002462 Bacteria 2632
80 Ga0466703_083496 3300042636 Bacteria 2424
81 Ga0466704_481464 3300042643 Bacteria 1326
82 Ga0466696_214109 3300042596 Bacteria 3629
83 Ga0466707_205685 3300042601 Bacteria 17644
84 Ga0466707_221265 3300042601 Bacteria 36581
85 Ga0466707_224774 3300042601 Bacteria 3875
86 Ga0466716_154085 3300042605 Bacteria 2615
87 Ga0123357_10147332 3300009784 Bacteria 2870
88 Ga0123353_10063400 3300010167 Bacteria 5928
89 Ga0466705_468781 3300042612 Bacteria 48519
90 Ga0466705_506132 3300042612 Bacteria 1753
91 Ga0466711_345521 3300042615 Bacteria 1114
92 Ga0466728_142814 3300042620 Bacteria 4940
93 Ga0466697_270147 3300042611 Bacteria 1357
94 Ga0466733_059399 3300042659 Bacteria 7629
95 Ga0466704_250722 3300042643 Bacteria 19399
96 Ga0466708_021828 3300042652 Bacteria 8339
97 Ga0466657_148868 3300042582 Bacteria 1129
98 Ga0466719_217902 3300042606 Bacteria 3359
99 Ga0466722_238925 3300042609 Bacteria 11060
100 Ga0123356_10044341 3300010049 Bacteria 4140
101 Ga0123356_10083398 3300010049 Bacteria 3028
102 Ga0123356_10085237 3300010049 Bacteria 2996
103 Ga0123356_10116384 3300010049 Bacteria 2592
104 Ga0123354_10148538 3300010882 Bacteria 2854
105 Ga0466705_468405 3300042612 Bacteria 6964
106 Ga0466715_340451 3300042616 Bacteria 1714

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042615 Ga0466711_319958 Ga0466711_319958_509_1372 287
2 3300010167 Ga0123353_10063400 Ga0123353_100634005 296
3 3300042620 Ga0466728_281052 Ga0466728_281052_2498_3490 305
4 3300042599 Ga0466706_075594 Ga0466706_075594_187077_188072 307
5 3300042643 Ga0466704_481464 Ga0466704_481464_304_1230 308
6 3300042616 Ga0466715_340451 Ga0466715_340451_282_1211 309
7 3300042652 Ga0466708_020469 Ga0466708_020469_217_1152 311
8 3300042612 Ga0466705_277411 Ga0466705_277411_5421_6359 312
9 3300042643 Ga0466704_092524 Ga0466704_092524_5099_6037 312
10 3300042636 Ga0466703_083496 Ga0466703_083496_1109_2050 313
11 3300042601 Ga0466707_142147 Ga0466707_142147_5979_6968 315
12 3300042596 Ga0466696_214109 Ga0466696_214109_1346_2299 317
13 3300042611 Ga0466697_270147 Ga0466697_270147_229_1224 317
14 3300042643 Ga0466704_250722 Ga0466704_250722_334_1287 317
15 3300002462 JGI24702J35022_10036370 JGI24702J35022_100363701 321
16 3300010167 Ga0123353_10034812 Ga0123353_100348125 321
17 3300042600 Ga0466700_348908 Ga0466700_348908_1290_2255 321
18 3300042635 Ga0466702_315269 Ga0466702_315269_193_1173 321
19 3300010167 Ga0123353_10030271 Ga0123353_100302715 325
20 3300042596 Ga0466696_410622 Ga0466696_410622_1338_2315 325
21 3300042582 Ga0466657_148868 Ga0466657_148868_66_1046 326
22 3300042590 Ga0466690_132802 Ga0466690_132802_228_1208 326
23 3300042602 Ga0466713_026803 Ga0466713_026803_26179_27159 326
24 3300042612 Ga0466705_506132 Ga0466705_506132_102_1082 326
25 3300042636 Ga0466703_279509 Ga0466703_279509_1539_2519 326
26 3300042643 Ga0466704_234403 Ga0466704_234403_8665_9645 326
27 3300042659 Ga0466733_067471 Ga0466733_067471_217_1197 326
28 iso_pr_bacteria 2820234266 2820235783 326
29 iso_pr_bacteria 2820314258 2820316033 326
30 iso_pr_bacteria 2820593525 2820593620 326
31 iso_pr_bacteria 2940228231 2940229562 326
32 3300002462 JGI24702J35022_10011976 JGI24702J35022_100119765 327
33 3300002504 JGI24705J35276_12237829 JGI24705J35276_1223782910 327
34 3300010049 Ga0123356_10016982 Ga0123356_100169822 327
35 3300010049 Ga0123356_10083398 Ga0123356_100833982 327
36 3300010167 Ga0123353_10075075 Ga0123353_100750753 327
37 3300010882 Ga0123354_10042951 Ga0123354_100429513 327
38 3300042615 Ga0466711_345521 Ga0466711_345521_87_1070 327
39 3300042619 Ga0466726_467723 Ga0466726_467723_11022_12005 327
40 3300042636 Ga0466703_091611 Ga0466703_091611_3206_4189 327
41 3300042643 Ga0466704_600801 Ga0466704_600801_442_1425 327
42 3300042652 Ga0466708_192881 Ga0466708_192881_4839_5822 327
43 3300010882 Ga0123354_10100343 Ga0123354_101003435 328
44 3300042593 Ga0466691_143017 Ga0466691_143017_459_1445 328
45 3300042601 Ga0466707_205685 Ga0466707_205685_6336_7322 328
46 3300042612 Ga0466705_322946 Ga0466705_322946_180_1166 328
47 3300042612 Ga0466705_468405 Ga0466705_468405_638_1624 328
48 3300042636 Ga0466703_338746 Ga0466703_338746_262_1248 328
49 3300042648 Ga0466709_341436 Ga0466709_341436_209_1195 328
50 3300042593 Ga0466691_041561 Ga0466691_041561_95_1084 329
51 3300042601 Ga0466707_013324 Ga0466707_013324_798_1787 329
52 3300042601 Ga0466707_147838 Ga0466707_147838_3293_4282 329
53 3300042601 Ga0466707_259060 Ga0466707_259060_37075_38064 329
54 3300042601 Ga0466707_352936 Ga0466707_352936_229_1218 329
55 3300042606 Ga0466719_023879 Ga0466719_023879_15324_16313 329
56 3300042606 Ga0466719_217902 Ga0466719_217902_2234_3223 329
57 3300042615 Ga0466711_409991 Ga0466711_409991_2708_3697 329
58 3300042616 Ga0466715_288361 Ga0466715_288361_220_1209 329
59 3300042618 Ga0466723_158643 Ga0466723_158643_13785_14774 329
60 3300042652 Ga0466708_021828 Ga0466708_021828_2786_3775 329
61 3300042655 Ga0466727_059909 Ga0466727_059909_603_1592 329
62 3300042655 Ga0466727_306941 Ga0466727_306941_2985_3974 329
63 3300010167 Ga0123353_10098134 Ga0123353_100981343 330
64 3300042601 Ga0466707_061153 Ga0466707_061153_2323_3315 330
65 3300042601 Ga0466707_221265 Ga0466707_221265_11410_12402 330
66 3300042601 Ga0466707_267681 Ga0466707_267681_9714_10706 330
67 3300042601 Ga0466707_323369 Ga0466707_323369_1812_2804 330
68 3300042612 Ga0466705_513740 Ga0466705_513740_3549_4541 330
69 3300042620 Ga0466728_142814 Ga0466728_142814_2497_3489 330
70 3300042621 Ga0466729_033681 Ga0466729_033681_164_1156 330
71 3300042643 Ga0466704_206743 Ga0466704_206743_6351_7343 330
72 3300042643 Ga0466704_609108 Ga0466704_609108_3451_4443 330
73 3300042659 Ga0466733_059399 Ga0466733_059399_4183_5175 330
74 2225789004 2227469385 2227913193 331
75 3300010167 Ga0123353_10012557 Ga0123353_100125579 331
76 3300042591 Ga0466692_025231 Ga0466692_025231_3380_4375 331
77 3300042596 Ga0466696_335622 Ga0466696_335622_92_1087 331
78 3300042605 Ga0466716_154085 Ga0466716_154085_1425_2420 331
79 3300042611 Ga0466697_244524 Ga0466697_244524_331_1326 331
80 iso_pr_bacteria 2820357977 2820358726 331
81 iso_pr_bacteria 2820412446 2820412516 331
82 3300009784 Ga0123357_10147332 Ga0123357_101473323 332
83 3300010049 Ga0123356_10044341 Ga0123356_100443413 332
84 3300010049 Ga0123356_10085237 Ga0123356_100852372 332
85 3300010049 Ga0123356_10226003 Ga0123356_102260032 332
86 3300010167 Ga0123353_10182065 Ga0123353_101820653 332
87 3300010167 Ga0123353_10280386 Ga0123353_102803863 332
88 3300010167 Ga0123353_10928472 Ga0123353_109284722 332
89 3300010882 Ga0123354_10001693 Ga0123354_100016935 332
90 3300042601 Ga0466707_201034 Ga0466707_201034_18183_19181 332
91 3300042609 Ga0466722_238925 Ga0466722_238925_1314_2312 332
92 3300010167 Ga0123353_10034424 Ga0123353_100344244 333
93 3300010882 Ga0123354_10148538 Ga0123354_101485383 333
94 3300042601 Ga0466707_084982 Ga0466707_084982_606_1607 333
95 3300010167 Ga0123353_10202746 Ga0123353_102027464 334
96 3300042616 Ga0466715_474526 Ga0466715_474526_2005_3009 334
97 3300042619 Ga0466726_362256 Ga0466726_362256_6334_7338 334
98 3300042659 Ga0466733_121195 Ga0466733_121195_185_1189 334
99 3300010049 Ga0123356_10006763 Ga0123356_100067636 335
100 3300010049 Ga0123356_10116384 Ga0123356_101163842 336
101 3300042602 Ga0466713_044186 Ga0466713_044186_23935_24945 336
102 3300042621 Ga0466729_077554 Ga0466729_077554_2254_3267 337
103 3300010167 Ga0123353_10114421 Ga0123353_101144215 338
104 3300042601 Ga0466707_051722 Ga0466707_051722_2348_3364 338
105 3300042612 Ga0466705_468781 Ga0466705_468781_17207_18229 340
106 3300042601 Ga0466707_224774 Ga0466707_224774_1150_2175 341
107 3300042601 Ga0466707_226499 Ga0466707_226499_828_1853 341
108 3300042616 Ga0466715_452243 Ga0466715_452243_9224_10258 344
109 3300042620 Ga0466728_273349 Ga0466728_273349_9034_10068 344
110 3300042652 Ga0466708_019882 Ga0466708_019882_6433_7467 344
111 3300042636 Ga0466703_087482 Ga0466703_087482_5152_6189 345
112 3300042612 Ga0466705_007712 Ga0466705_007712_4242_5333 363

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00579 tRNA-synt_1b tRNA synthetases class I (W and Y) 36 316 0.97

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.83 0.88 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.