Protein Family IF06964

Metagenome Isolate
125 Members
39 Samples
104 Scaffolds
110.05 Avg Length

🧬 Representative Sequence

ID
3300042610|Ga0466698_479421|Ga0466698_479421_34_399
Length
121 aa
Sequence
MFLRGNVLETVQTVRIEQWNDIRELALMSIGTDKGTWWADPNFGSELWLLRKNGKVDGRTAGTLRRMVLESLQWIIQSSLAAKINCTAERTGKNEIRYIVSIFRPNETKSSVLITEVWSAV

📊 Sample Types

Isolate 1.6%
Metagenome 98.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.4%
Kalotermitidae 33.3%
Rhinotermitidae 8.3%
Unclassified 8.3%
Termopsidae 5.6%

🌳 Taxonomy

Archaea 0
Bacteria 97
Eukaryota 0
Viruses 0
Unclassified 28

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2030936001 Nasutitermes corniger hindgut microbial communities from Florida, USA Metagenome Termitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
5 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
6 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
7 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
8 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
9 3300005485 Termite gut microbial communities from Costa Rica - P3 luminal contents Metagenome Termitidae
10 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
11 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
12 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
13 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
14 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
15 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
16 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
17 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
18 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
19 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
20 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
25 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
26 2781125632 Treponema sp. Co191P1bin87 Isolate Unclassified
27 3300001880 Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome Metagenome
28 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
29 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
30 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
31 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
32 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
33 2781125644 Treponema sp. Co191P3bin12 Isolate Unclassified
34 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
35 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
36 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
37 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
38 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
39 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466732_295913 3300042656 Bacteria 16550
2 Ga0123353_11812577 3300010167 Bacteria 758
3 Ga0466694_246076 3300042594 Bacteria 1114
4 Ga0466699_250151 3300042597 Bacteria 1013
5 JGI24698J34947_10000613 3300002449 Bacteria 17091
6 JGI24695J34938_10003411 3300002450 Bacteria 11124
7 JGI24695J34938_10003877 3300002450 Bacteria 10133
8 JGI24695J34938_10025628 3300002450 Bacteria 2816
9 JGI24695J34938_10246977 3300002450 Bacteria 756
10 Ga0072941_1000286 3300005201 Bacteria 19710
11 Ga0466712_308307 3300042614 Bacteria 10494
12 Ga0466715_093862 3300042616 Bacteria 7772
13 Ga0466702_297609 3300042635 Unclassified 2912
14 Ga0466703_049597 3300042636 Bacteria 1182
15 Ga0466727_339955 3300042655 Bacteria 4960
16 Ga0466719_103264 3300042606 Bacteria 1215
17 Ga0466719_308098 3300042606 Bacteria 6804
18 Ga0466720_037845 3300042607 Bacteria 4339
19 Ga0466696_343869 3300042596 Bacteria 11755
20 Ga0466726_159147 3300042619 Bacteria 2042
21 Ga0466729_008983 3300042621 Bacteria 1312
22 Ga0466705_316743 3300042612 Bacteria 1659
23 Ga0466703_083946 3300042636 Bacteria 1125
24 Ga0466704_112178 3300042643 Bacteria 8161
25 Ga0466704_531358 3300042643 Unclassified 7074
26 Ga0264413_126100 3300024493 Bacteria 5514
27 Ga0466690_064867 3300042590 Bacteria 9265
28 Ga0466691_099796 3300042593 Unclassified 15324
29 Nasutiter_Contig23930 2030936001 Bacteria 1094
30 JGI24695J34938_10006673 3300002450 Bacteria 6877
31 Ga0072941_1047660 3300005201 Bacteria 22444
32 Ga0074263_114126 3300005485 Unclassified 2366
33 Ga0466728_230368 3300042620 Bacteria 10449
34 Ga0466705_212156 3300042612 Bacteria 1149
35 Ga0466705_297353 3300042612 Bacteria 2332
36 Ga0466704_181573 3300042643 Bacteria 8885
37 Ga0466704_424954 3300042643 Bacteria 11238
38 Ga0466704_479147 3300042643 Bacteria 7271
39 Ga0466692_143044 3300042591 Bacteria 3269
40 Ga0466691_217688 3300042593 Bacteria 8468
41 Ga0466699_404169 3300042597 Bacteria 6620
42 FAAS_10268161 3300001880 Unclassified 544
43 JGI24695J34938_10020120 3300002450 Unclassified 3290
44 Ga0072941_1186663 3300005201 Bacteria 3425
45 Ga0466712_072806 3300042614 Bacteria 22773
46 Ga0466712_316861 3300042614 Bacteria 11224
47 Ga0466718_071072 3300042617 Bacteria 5637
48 Ga0466718_080737 3300042617 Bacteria 6281
49 Ga0466728_075348 3300042620 Bacteria 12175
50 Ga0466709_007728 3300042648 Bacteria 3884
51 Ga0466694_025146 3300042594 Bacteria 18613
52 Ga0466694_069393 3300042594 Bacteria 7157
53 JGI24698J34947_10000802 3300002449 Bacteria 15615
54 JGI24695J34938_10023344 3300002450 Bacteria 2984
55 JGI24702J35022_10012470 3300002462 Bacteria 4724
56 Ga0072940_1031916 3300005200 Bacteria 1262
57 Ga0072941_1042120 3300005201 Bacteria 20802
58 Ga0466711_514638 3300042615 Bacteria 5101
59 Ga0466726_438334 3300042619 Bacteria 1375
60 Ga0466704_125939 3300042643 Bacteria 2299
61 Ga0466704_238545 3300042643 Bacteria 1721
62 Ga0466707_062430 3300042601 Bacteria 4124
63 Ga0466694_217529 3300042594 Bacteria 7082
64 AustNasuHG_c1004547 3300000089 Bacteria 4973
65 JGI24702J35022_10006198 3300002462 Unclassified 6927
66 Ga0072940_1427342 3300005200 Bacteria 2346
67 Ga0072941_1088287 3300005201 Bacteria 7416
68 Ga0466715_077706 3300042616 Bacteria 2166
69 Ga0466718_065323 3300042617 Unclassified 1224
70 Ga0466728_107606 3300042620 Bacteria 3837
71 Ga0466705_285853 3300042612 Bacteria 4065
72 Ga0466703_057752 3300042636 Bacteria 5797
73 Ga0466727_146235 3300042655 Bacteria 1417
74 Ga0466716_130648 3300042605 Bacteria 4963
75 Ga0466722_082139 3300042609 Bacteria 3231
76 Ga0466722_093438 3300042609 Bacteria 3128
77 Ga0466732_229842 3300042656 Bacteria 1885
78 Ga0264413_134479 3300024493 Bacteria 1492
79 Ga0466694_033990 3300042594 Bacteria 1869
80 Ga0072940_1240755 3300005200 Bacteria 1758
81 Ga0466705_497629 3300042612 Bacteria 1044
82 Ga0466715_311509 3300042616 Bacteria 4204
83 Ga0466703_009262 3300042636 Bacteria 5159
84 Ga0466703_142970 3300042636 Bacteria 9391
85 Ga0466722_023380 3300042609 Unclassified 1847
86 Ga0466698_479421 3300042610 Bacteria 1433
87 Ga0466732_390059 3300042656 Bacteria 2692
88 Ga0466690_131266 3300042590 Bacteria 3381
89 Ga0466692_007132 3300042591 Bacteria 14458
90 Ga0466691_080069 3300042593 Bacteria 7505
91 Ga0466691_104538 3300042593 Bacteria 6965
92 AustNasuHG_c1001421 3300000089 Bacteria 8566
93 JGI24698J34947_10271899 3300002449 Bacteria 623
94 Ga0074263_104058 3300005485 Bacteria 2324
95 Ga0466711_379736 3300042615 Bacteria 3644
96 Ga0466715_397126 3300042616 Bacteria 1356
97 Ga0466715_579187 3300042616 Bacteria 2263
98 Ga0466718_069585 3300042617 Bacteria 44279
99 Ga0466726_019297 3300042619 Bacteria 3926
100 Ga0466726_423090 3300042619 Bacteria 19392
101 Ga0466728_043644 3300042620 Bacteria 1985
102 Ga0466729_173657 3300042621 Bacteria 4733
103 Ga0466705_336193 3300042612 Bacteria 2745
104 Ga0466719_073741 3300042606 Bacteria 8139

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042609 Ga0466722_093438 Ga0466722_093438_674_952 92
2 3300042609 Ga0466722_093438 Ga0466722_093438_674_952 92
3 3300042636 Ga0466703_083946 Ga0466703_083946_827_1108 93
4 3300042594 Ga0466694_025146 Ga0466694_025146_2302_2622 106
5 3300042601 Ga0466707_062430 Ga0466707_062430_1509_1829 106
6 3300042617 Ga0466718_069585 Ga0466718_069585_36506_36826 106
7 3300042619 Ga0466726_438334 Ga0466726_438334_944_1264 106
8 3300042619 Ga0466726_438334 Ga0466726_438334_944_1264 106
9 3300002449 JGI24698J34947_10000802 JGI24698J34947_100008024 108
10 3300024493 Ga0264413_126100 Ga0264413_1261002 108
11 3300042590 Ga0466690_064867 Ga0466690_064867_2087_2413 108
12 3300042590 Ga0466690_131266 Ga0466690_131266_702_1028 108
13 3300042590 Ga0466690_131266 Ga0466690_131266_702_1028 108
14 3300042591 Ga0466692_007132 Ga0466692_007132_7774_8100 108
15 3300042593 Ga0466691_099796 Ga0466691_099796_6990_7316 108
16 3300042594 Ga0466694_033990 Ga0466694_033990_1531_1857 108
17 3300042596 Ga0466696_343869 Ga0466696_343869_9445_9771 108
18 3300042605 Ga0466716_130648 Ga0466716_130648_449_775 108
19 3300042605 Ga0466716_130648 Ga0466716_130648_449_775 108
20 3300042606 Ga0466719_073741 Ga0466719_073741_720_1046 108
21 3300042609 Ga0466722_023380 Ga0466722_023380_1239_1565 108
22 3300042609 Ga0466722_082139 Ga0466722_082139_1624_1950 108
23 3300042609 Ga0466722_082139 Ga0466722_082139_1624_1950 108
24 3300042612 Ga0466705_212156 Ga0466705_212156_198_524 108
25 3300042612 Ga0466705_212156 Ga0466705_212156_198_524 108
26 3300042612 Ga0466705_497629 Ga0466705_497629_341_667 108
27 3300042612 Ga0466705_497629 Ga0466705_497629_341_667 108
28 3300042614 Ga0466712_316861 Ga0466712_316861_7826_8152 108
29 3300042616 Ga0466715_397126 Ga0466715_397126_876_1202 108
30 3300042617 Ga0466718_071072 Ga0466718_071072_1921_2247 108
31 3300042619 Ga0466726_159147 Ga0466726_159147_1233_1559 108
32 3300042619 Ga0466726_423090 Ga0466726_423090_6735_7061 108
33 3300042620 Ga0466728_043644 Ga0466728_043644_1315_1641 108
34 3300042620 Ga0466728_075348 Ga0466728_075348_7212_7538 108
35 3300042636 Ga0466703_057752 Ga0466703_057752_4289_4615 108
36 3300042643 Ga0466704_181573 Ga0466704_181573_488_814 108
37 3300042643 Ga0466704_238545 Ga0466704_238545_191_517 108
38 3300042643 Ga0466704_238545 Ga0466704_238545_191_517 108
39 3300042643 Ga0466704_424954 Ga0466704_424954_2557_2883 108
40 3300042643 Ga0466704_479147 Ga0466704_479147_1091_1417 108
41 3300042648 Ga0466709_007728 Ga0466709_007728_3346_3672 108
42 3300042655 Ga0466727_146235 Ga0466727_146235_397_723 108
43 3300042656 Ga0466732_295913 Ga0466732_295913_2842_3168 108
44 3300000089 AustNasuHG_c1004547 AustNasuHG_10045474 109
45 3300005200 Ga0072940_1031916 Ga0072940_10319162 109
46 3300005200 Ga0072940_1031916 Ga0072940_10319162 109
47 3300005201 Ga0072941_1000286 Ga0072941_100028623 109
48 3300010167 Ga0123353_11812577 Ga0123353_118125772 109
49 3300024493 Ga0264413_134479 Ga0264413_1344793 109
50 3300024493 Ga0264413_134479 Ga0264413_1344793 109
51 3300042591 Ga0466692_143044 Ga0466692_143044_799_1128 109
52 3300042591 Ga0466692_143044 Ga0466692_143044_799_1128 109
53 3300042593 Ga0466691_080069 Ga0466691_080069_6318_6647 109
54 3300042615 Ga0466711_379736 Ga0466711_379736_72_401 109
55 3300042615 Ga0466711_379736 Ga0466711_379736_72_401 109
56 3300042615 Ga0466711_514638 Ga0466711_514638_1795_2124 109
57 3300042616 Ga0466715_579187 Ga0466715_579187_1843_2172 109
58 3300042619 Ga0466726_019297 Ga0466726_019297_566_895 109
59 3300042619 Ga0466726_019297 Ga0466726_019297_566_895 109
60 2030936001 Nasutiter_Contig23930 Nasutiterm_1615890 110
61 3300000089 AustNasuHG_c1001421 AustNasuHG_10014215 110
62 3300005200 Ga0072940_1240755 Ga0072940_12407553 110
63 3300005200 Ga0072940_1427342 Ga0072940_14273423 110
64 3300005201 Ga0072941_1042120 Ga0072941_10421204 110
65 3300005201 Ga0072941_1047660 Ga0072941_10476607 110
66 3300042593 Ga0466691_104538 Ga0466691_104538_2692_3024 110
67 3300042607 Ga0466720_037845 Ga0466720_037845_281_613 110
68 3300042607 Ga0466720_037845 Ga0466720_037845_281_613 110
69 3300042612 Ga0466705_285853 Ga0466705_285853_1665_1997 110
70 3300042616 Ga0466715_077706 Ga0466715_077706_751_1083 110
71 3300042616 Ga0466715_093862 Ga0466715_093862_2672_3004 110
72 3300042620 Ga0466728_107606 Ga0466728_107606_3223_3555 110
73 3300042621 Ga0466729_008983 Ga0466729_008983_813_1145 110
74 3300042636 Ga0466703_009262 Ga0466703_009262_638_970 110
75 3300042636 Ga0466703_049597 Ga0466703_049597_618_950 110
76 3300042643 Ga0466704_531358 Ga0466704_531358_5640_5972 110
77 3300042655 Ga0466727_339955 Ga0466727_339955_3815_4147 110
78 iso_pr_bacteria 2781125632 2781271107 110
79 3300001880 FAAS_10268161 FAAS_102681611 111
80 3300002449 JGI24698J34947_10271899 JGI24698J34947_102718992 111
81 3300002450 JGI24695J34938_10020120 JGI24695J34938_100201203 111
82 3300002462 JGI24702J35022_10006198 JGI24702J35022_100061986 111
83 3300005201 Ga0072941_1186663 Ga0072941_11866632 111
84 3300005485 Ga0074263_104058 Ga0074263_1040584 111
85 3300005485 Ga0074263_104058 Ga0074263_1040584 111
86 3300005485 Ga0074263_114126 Ga0074263_1141263 111
87 3300042593 Ga0466691_217688 Ga0466691_217688_2367_2702 111
88 3300042594 Ga0466694_069393 Ga0466694_069393_4418_4753 111
89 3300042620 Ga0466728_230368 Ga0466728_230368_7618_7953 111
90 3300002449 JGI24698J34947_10000613 JGI24698J34947_100006133 112
91 3300002462 JGI24702J35022_10012470 JGI24702J35022_100124704 112
92 3300005201 Ga0072941_1088287 Ga0072941_10882874 112
93 3300005201 Ga0072941_1088287 Ga0072941_10882874 112
94 3300042606 Ga0466719_103264 Ga0466719_103264_800_1138 112
95 3300042612 Ga0466705_297353 Ga0466705_297353_148_486 112
96 3300042612 Ga0466705_336193 Ga0466705_336193_1196_1534 112
97 3300042612 Ga0466705_336193 Ga0466705_336193_1196_1534 112
98 3300042643 Ga0466704_125939 Ga0466704_125939_1082_1420 112
99 3300042594 Ga0466694_217529 Ga0466694_217529_3721_4062 113
100 3300042594 Ga0466694_246076 Ga0466694_246076_653_994 113
101 3300042597 Ga0466699_250151 Ga0466699_250151_474_815 113
102 3300042597 Ga0466699_404169 Ga0466699_404169_3156_3497 113
103 3300042614 Ga0466712_072806 Ga0466712_072806_5418_5759 113
104 3300042614 Ga0466712_308307 Ga0466712_308307_2718_3059 113
105 3300042617 Ga0466718_080737 Ga0466718_080737_3015_3356 113
106 3300042635 Ga0466702_297609 Ga0466702_297609_1370_1711 113
107 3300042636 Ga0466703_142970 Ga0466703_142970_8724_9065 113
108 3300042643 Ga0466704_112178 Ga0466704_112178_2576_2917 113
109 3300002450 JGI24695J34938_10023344 JGI24695J34938_100233442 114
110 3300002450 JGI24695J34938_10025628 JGI24695J34938_100256284 114
111 3300002450 JGI24695J34938_10025628 JGI24695J34938_100256284 114
112 3300042606 Ga0466719_308098 Ga0466719_308098_2591_2935 114
113 3300042612 Ga0466705_316743 Ga0466705_316743_595_939 114
114 3300042616 Ga0466715_311509 Ga0466715_311509_271_615 114
115 3300042621 Ga0466729_173657 Ga0466729_173657_659_1003 114
116 3300042617 Ga0466718_065323 Ga0466718_065323_46_396 116
117 3300042656 Ga0466732_229842 Ga0466732_229842_1353_1703 116
118 iso_pr_bacteria 2781125644 2781297097 116
119 3300002450 JGI24695J34938_10003411 JGI24695J34938_1000341110 117
120 3300002450 JGI24695J34938_10003877 JGI24695J34938_1000387710 117
121 3300002450 JGI24695J34938_10006673 JGI24695J34938_1000667310 117
122 3300002450 JGI24695J34938_10246977 JGI24695J34938_102469772 118
123 3300042656 Ga0466732_390059 Ga0466732_390059_2323_2682 119
124 3300042610 Ga0466698_479421 Ga0466698_479421_34_399 121
125 3300042610 Ga0466698_479421 Ga0466698_479421_34_399 121

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF07409 GP46 Phage protein GP46 31 108 0.82

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.71 0.78 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.