Protein Family IF06945
Metagenome
Isolate
138
Members
52
Samples
127
Scaffolds
312.49
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_245888|Ga0466698_245888_1005_2138
- Length
- 377 aa
- Sequence
- MPYQQQNNSYHRESKVTRHVTLINYKKSVELSYAYKEKTMQIPEPAKTPAFYFVGVTTGQSSIMKVFPKWAEILGLQADIRGIDLPLHAPPDDYRKAAQFMKDDGLSLGGLVTTHKLDMYKACRDIFDYIDPFGEKLEEVSCLSKKDGQFRAHAKDPITSGLALEAFVPVNYWKEKGGEVLLLGAGGSSLAMSLYFAQEKHSGNMPKRITIANRSEPRLVSAKEALQGLNGQIEFRFVHSPTPKDNDRLIAELPPYSLIVNATGLGKDAPGSPATDSVSFPRDSLVWEINYRGDLLFMRQAQAQQREKNLHVEDGWMYFIHGWTEVIAEVFHIDIDSKVLEKLSAIAQANRRRRIMTGNIEWVSGTAEDFDLLTGLS
Sample Types
Isolate
8.0%
Metagenome
92.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
38.5%
Kalotermitidae
26.9%
Unclassified
25.0%
Rhinotermitidae
5.8%
Termopsidae
3.8%
Taxonomy
Archaea
0
Bacteria
128
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820533259 | Unclassified Firmicutes Lab288P1bin140 | Isolate | Unclassified |
| 2 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 12 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 13 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 14 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 15 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 16 | 2820535361 | Unclassified Firmicutes Lab288P1bin14 | Isolate | Unclassified |
| 17 | 2820573558 | Unclassified Firmicutes Emb289P3bin140 | Isolate | Unclassified |
| 18 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 19 | 2820602899 | Unclassified Firmicutes Emb289P1bin51 | Isolate | Unclassified |
| 20 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 21 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 22 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 23 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 24 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 25 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 26 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 27 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 28 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 31 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 32 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 33 | 2820666966 | Unclassified Firmicutes Co191P3bin39 | Isolate | Unclassified |
| 34 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 35 | 2781125681 | Treponema sp. Lab288P1bin11 | Isolate | Unclassified |
| 36 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 37 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 38 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 39 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 40 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 41 | 3300002501 | Neocapritermes taracua P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P1 | Metagenome | Termitidae |
| 42 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 43 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 44 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 45 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 46 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 47 | 2820265624 | Unclassified Firmicutes Th196P3bin36 | Isolate | Unclassified |
| 48 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 49 | 2820702360 | Unclassified Firmicutes Co191P1bin4 | Isolate | Unclassified |
| 50 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 51 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 52 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466713_066031 | 3300042602 | Bacteria | 72966 |
| 2 | Ga0466717_141080 | 3300042604 | Bacteria | 1851 |
| 3 | Ga0466720_117372 | 3300042607 | Bacteria | 29633 |
| 4 | Ga0466729_228951 | 3300042621 | Bacteria | 8066 |
| 5 | Ga0466709_284196 | 3300042648 | Bacteria | 18825 |
| 6 | Ga0466727_069357 | 3300042655 | Bacteria | 5370 |
| 7 | Ga0466692_046639 | 3300042591 | Bacteria | 23631 |
| 8 | Ga0466691_023496 | 3300042593 | Bacteria | 5650 |
| 9 | JGI24698J34947_10044077 | 3300002449 | Bacteria | 2285 |
| 10 | Ga0466711_156486 | 3300042615 | Bacteria | 1469 |
| 11 | Ga0466705_070665 | 3300042612 | Bacteria | 7282 |
| 12 | Ga0466705_082747 | 3300042612 | Bacteria | 9066 |
| 13 | Ga0466705_243783 | 3300042612 | Bacteria | 3148 |
| 14 | Ga0466716_060236 | 3300042605 | Bacteria | 3922 |
| 15 | Ga0466716_121255 | 3300042605 | Unclassified | 1756 |
| 16 | Ga0466704_011869 | 3300042643 | Bacteria | 7490 |
| 17 | Ga0466727_256159 | 3300042655 | Bacteria | 1193 |
| 18 | Ga0123357_10102169 | 3300009784 | Bacteria | 3692 |
| 19 | Ga0123355_10162742 | 3300009826 | Bacteria | 3357 |
| 20 | Ga0123356_10063725 | 3300010049 | Bacteria | 3445 |
| 21 | Ga0466692_014024 | 3300042591 | Bacteria | 3076 |
| 22 | Ga0466693_202582 | 3300042592 | Bacteria | 1057 |
| 23 | Ga0466691_177490 | 3300042593 | Bacteria | 7343 |
| 24 | Ga0466696_130912 | 3300042596 | Bacteria | 3785 |
| 25 | Ga0466711_064090 | 3300042615 | Bacteria | 1148 |
| 26 | Ga0466711_304771 | 3300042615 | Bacteria | 4133 |
| 27 | Ga0466723_268749 | 3300042618 | Unclassified | 3393 |
| 28 | Ga0466705_287142 | 3300042612 | Bacteria | 1790 |
| 29 | Ga0466705_311400 | 3300042612 | Bacteria | 2108 |
| 30 | Ga0466707_124629 | 3300042601 | Unclassified | 1511 |
| 31 | Ga0466722_207655 | 3300042609 | Bacteria | 8578 |
| 32 | Ga0466698_138998 | 3300042610 | Bacteria | 1707 |
| 33 | Ga0466704_160392 | 3300042643 | Bacteria | 3008 |
| 34 | Ga0466708_436511 | 3300042652 | Bacteria | 1840 |
| 35 | Ga0123355_10023791 | 3300009826 | Bacteria | 9840 |
| 36 | Ga0123355_10353025 | 3300009826 | Bacteria | 1946 |
| 37 | Ga0123353_10138693 | 3300010167 | Bacteria | 3898 |
| 38 | Ga0415639_163770 | 3300038395 | Bacteria | 3216 |
| 39 | Ga0466696_020290 | 3300042596 | Bacteria | 17438 |
| 40 | JGI24699J35502_11113011 | 3300002509 | Bacteria | 2788 |
| 41 | Ga0466711_284728 | 3300042615 | Bacteria | 4554 |
| 42 | Ga0466723_015663 | 3300042618 | Bacteria | 58778 |
| 43 | Ga0466726_031506 | 3300042619 | Bacteria | 7209 |
| 44 | Ga0466716_171734 | 3300042605 | Bacteria | 1698 |
| 45 | Ga0466719_441935 | 3300042606 | Bacteria | 11138 |
| 46 | Ga0466698_245888 | 3300042610 | Unclassified | 2247 |
| 47 | Ga0466703_243022 | 3300042636 | Bacteria | 15617 |
| 48 | Ga0466703_299542 | 3300042636 | Bacteria | 22133 |
| 49 | Ga0466709_018916 | 3300042648 | Bacteria | 6081 |
| 50 | Ga0466725_261980 | 3300042654 | Unclassified | 9636 |
| 51 | Ga0123357_10024492 | 3300009784 | Unclassified | 8126 |
| 52 | Ga0123357_10171815 | 3300009784 | Bacteria | 2561 |
| 53 | Ga0123357_10329401 | 3300009784 | Bacteria | 1495 |
| 54 | Ga0123356_10082512 | 3300010049 | Bacteria | 3043 |
| 55 | Ga0123353_10133326 | 3300010167 | Bacteria | 3985 |
| 56 | Ga0466692_123356 | 3300042591 | Bacteria | 1092 |
| 57 | JGI24695J34938_10000040 | 3300002450 | Bacteria | 97045 |
| 58 | Ga0466712_131579 | 3300042614 | Bacteria | 27791 |
| 59 | Ga0466712_133266 | 3300042614 | Bacteria | 38197 |
| 60 | Ga0466711_274098 | 3300042615 | Bacteria | 26177 |
| 61 | Ga0466723_161634 | 3300042618 | Bacteria | 7090 |
| 62 | Ga0466723_183835 | 3300042618 | Bacteria | 1275 |
| 63 | Ga0466714_031392 | 3300042603 | Bacteria | 2585 |
| 64 | Ga0466716_211680 | 3300042605 | Bacteria | 1043 |
| 65 | Ga0466722_029222 | 3300042609 | Bacteria | 3633 |
| 66 | Ga0466698_033571 | 3300042610 | Bacteria | 3002 |
| 67 | Ga0466698_335901 | 3300042610 | Bacteria | 3820 |
| 68 | Ga0466703_024190 | 3300042636 | Bacteria | 22279 |
| 69 | Ga0466703_274955 | 3300042636 | Bacteria | 2849 |
| 70 | Ga0466704_297275 | 3300042643 | Bacteria | 20574 |
| 71 | Ga0466727_047615 | 3300042655 | Bacteria | 11731 |
| 72 | Ga0466727_283003 | 3300042655 | Bacteria | 2411 |
| 73 | Ga0123355_10003626 | 3300009826 | Bacteria | 22238 |
| 74 | Ga0123355_10004233 | 3300009826 | Bacteria | 20847 |
| 75 | Ga0466699_072488 | 3300042597 | Bacteria | 13556 |
| 76 | JGI24695J34938_10019789 | 3300002450 | Bacteria | 3325 |
| 77 | Ga0466718_122724 | 3300042617 | Bacteria | 29201 |
| 78 | Ga0466726_093682 | 3300042619 | Bacteria | 1348 |
| 79 | Ga0466728_445722 | 3300042620 | Bacteria | 5382 |
| 80 | Ga0466713_030402 | 3300042602 | Bacteria | 14822 |
| 81 | Ga0466716_490848 | 3300042605 | Bacteria | 3806 |
| 82 | Ga0466719_005015 | 3300042606 | Unclassified | 4434 |
| 83 | Ga0466722_039124 | 3300042609 | Bacteria | 4035 |
| 84 | Ga0466704_063745 | 3300042643 | Bacteria | 39367 |
| 85 | Ga0466704_209227 | 3300042643 | Bacteria | 22130 |
| 86 | Ga0123355_10002234 | 3300009826 | Bacteria | 27344 |
| 87 | Ga0123355_10002319 | 3300009826 | Bacteria | 26885 |
| 88 | Ga0123354_10150574 | 3300010882 | Bacteria | 2821 |
| 89 | Ga0123354_10344883 | 3300010882 | Bacteria | 1337 |
| 90 | Ga0466691_048165 | 3300042593 | Bacteria | 15053 |
| 91 | Ga0466691_137442 | 3300042593 | Bacteria | 18156 |
| 92 | Ga0466696_294185 | 3300042596 | Bacteria | 1178 |
| 93 | Ga0466696_348667 | 3300042596 | Bacteria | 1371 |
| 94 | JGI24698J34947_10000007 | 3300002449 | Bacteria | 54610 |
| 95 | JGI24695J34938_10003528 | 3300002450 | Bacteria | 10845 |
| 96 | Ga0466711_205529 | 3300042615 | Bacteria | 7137 |
| 97 | Ga0466705_231821 | 3300042612 | Bacteria | 3969 |
| 98 | Ga0466707_371544 | 3300042601 | Bacteria | 11694 |
| 99 | Ga0466719_017114 | 3300042606 | Bacteria | 8024 |
| 100 | Ga0466703_046543 | 3300042636 | Bacteria | 3580 |
| 101 | Ga0466704_181791 | 3300042643 | Bacteria | 10950 |
| 102 | Ga0466708_165474 | 3300042652 | Bacteria | 34114 |
| 103 | Ga0466708_341343 | 3300042652 | Bacteria | 32119 |
| 104 | Ga0466708_446124 | 3300042652 | Bacteria | 2428 |
| 105 | Ga0466691_026214 | 3300042593 | Bacteria | 4802 |
| 106 | Ga0466691_175486 | 3300042593 | Bacteria | 12157 |
| 107 | Ga0466699_231906 | 3300042597 | Bacteria | 29115 |
| 108 | JGI24703J35330_11743455 | 3300002501 | Bacteria | 3910 |
| 109 | Ga0466723_127145 | 3300042618 | Bacteria | 6078 |
| 110 | Ga0466726_345393 | 3300042619 | Bacteria | 1736 |
| 111 | Ga0466705_193049 | 3300042612 | Bacteria | 40502 |
| 112 | Ga0466732_000909 | 3300042656 | Bacteria | 4192 |
| 113 | Ga0466719_144230 | 3300042606 | Bacteria | 30295 |
| 114 | Ga0466703_025455 | 3300042636 | Bacteria | 6125 |
| 115 | Ga0466704_226266 | 3300042643 | Bacteria | 6083 |
| 116 | Ga0466704_529865 | 3300042643 | Bacteria | 1299 |
| 117 | Ga0466727_182103 | 3300042655 | Unclassified | 7025 |
| 118 | Ga0466727_334802 | 3300042655 | Unclassified | 10764 |
| 119 | Ga0123356_10072182 | 3300010049 | Bacteria | 3242 |
| 120 | Ga0123356_10693923 | 3300010049 | Unclassified | 1187 |
| 121 | Ga0123356_10791988 | 3300010049 | Bacteria | 1119 |
| 122 | Ga0123353_10356198 | 3300010167 | Bacteria | 2202 |
| 123 | Ga0466690_424112 | 3300042590 | Bacteria | 2925 |
| 124 | Ga0466692_119330 | 3300042591 | Bacteria | 10335 |
| 125 | Ga0466715_428846 | 3300042616 | Bacteria | 3754 |
| 126 | Ga0466718_153859 | 3300042617 | Bacteria | 1509 |
| 127 | Ga0466723_245079 | 3300042618 | Bacteria | 2326 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.