Protein Family IF06940
Metagenome
Isolate
274
Members
53
Samples
267
Scaffolds
140.77
Avg Length
Representative Sequence
- ID
- 3300042610|Ga0466698_173335|Ga0466698_173335_2664_3173
- Length
- 169 aa
- Sequence
- LGKSEKRRNRPFRSGKENTKAFTSGAAVRMSKRERLDDSNTVVLGKTTSFTGMLKFETTLKIQGTFKGTIEASGALIVDKDAVVEADHITVSSLTVYGSISGTVFAMDKVDMMSGARVHGDVSASRLRIADGVLFEGKCKMTGVEKDVEIFQRPTEEIKADLQRVNGRA
Sample Types
Isolate
2.5%
Metagenome
97.5%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.1%
Kalotermitidae
27.5%
Unclassified
15.7%
Termopsidae
7.8%
Rhinotermitidae
3.9%
Hodotermitidae
2.0%
Taxonomy
Archaea
1
Bacteria
256
Eukaryota
0
Viruses
0
Unclassified
17
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 2 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 3 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 4 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 5 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 6 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 7 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 8 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 11 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 12 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 13 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 14 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 15 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 16 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 17 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 18 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 19 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 20 | 3300042582 | Termite gut microbial communities of Astalotermes quietus from Ebogo II, Mbalmayo, Cameroon - Ast373 | Metagenome | Termitidae |
| 21 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 22 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 23 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 24 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 25 | 2781125666 | Treponema sp. Emb289P4bin7 | Isolate | Unclassified |
| 26 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 27 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 33 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 34 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 35 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 36 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 37 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 38 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 39 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 40 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 41 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 42 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 43 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 44 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 45 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 46 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 47 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 48 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 49 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 50 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 51 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
| 52 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 53 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_060570 | 3300042612 | Bacteria | 7895 |
| 2 | Ga0466705_378327 | 3300042612 | Bacteria | 13916 |
| 3 | Ga0466731_089501 | 3300042622 | Bacteria | 1880 |
| 4 | Ga0466702_170474 | 3300042635 | Bacteria | 1507 |
| 5 | Ga0466702_294850 | 3300042635 | Bacteria | 2232 |
| 6 | Ga0466703_054286 | 3300042636 | Bacteria | 6599 |
| 7 | Ga0466704_475026 | 3300042643 | Bacteria | 6670 |
| 8 | Ga0466708_083834 | 3300042652 | Bacteria | 5493 |
| 9 | Ga0466727_146040 | 3300042655 | Bacteria | 1923 |
| 10 | Ga0466727_212897 | 3300042655 | Bacteria | 2162 |
| 11 | Ga0466707_348086 | 3300042601 | Bacteria | 2009 |
| 12 | Ga0466720_204733 | 3300042607 | Unclassified | 5634 |
| 13 | Ga0466722_076070 | 3300042609 | Bacteria | 3358 |
| 14 | Ga0466722_246147 | 3300042609 | Bacteria | 5319 |
| 15 | Ga0123354_10204519 | 3300010882 | Bacteria | 2157 |
| 16 | Ga0466691_007584 | 3300042593 | Bacteria | 4436 |
| 17 | Ga0466694_045184 | 3300042594 | Bacteria | 11288 |
| 18 | Ga0466694_178028 | 3300042594 | Bacteria | 4373 |
| 19 | Ga0466699_427244 | 3300042597 | Bacteria | 1079 |
| 20 | JGI24698J34947_10016650 | 3300002449 | Bacteria | 3988 |
| 21 | JGI24698J34947_10152083 | 3300002449 | Unclassified | 959 |
| 22 | Ga0466712_163902 | 3300042614 | Bacteria | 14253 |
| 23 | Ga0466711_005298 | 3300042615 | Bacteria | 5799 |
| 24 | Ga0466715_503723 | 3300042616 | Bacteria | 2157 |
| 25 | Ga0466715_592578 | 3300042616 | Bacteria | 8651 |
| 26 | Ga0466723_024084 | 3300042618 | Bacteria | 42350 |
| 27 | Ga0466723_288152 | 3300042618 | Bacteria | 2685 |
| 28 | Ga0466726_332639 | 3300042619 | Bacteria | 2006 |
| 29 | Ga0466728_126732 | 3300042620 | Bacteria | 8204 |
| 30 | Ga0466728_425107 | 3300042620 | Bacteria | 3929 |
| 31 | Ga0466733_157026 | 3300042659 | Bacteria | 2523 |
| 32 | Ga0466730_007035 | 3300042625 | Bacteria | 1156 |
| 33 | Ga0466702_091090 | 3300042635 | Bacteria | 2495 |
| 34 | Ga0466702_222616 | 3300042635 | Bacteria | 2295 |
| 35 | Ga0466703_030434 | 3300042636 | Bacteria | 2508 |
| 36 | Ga0466704_192576 | 3300042643 | Bacteria | 5266 |
| 37 | Ga0466704_363579 | 3300042643 | Bacteria | 24250 |
| 38 | Ga0466709_411737 | 3300042648 | Bacteria | 11793 |
| 39 | Ga0466716_420961 | 3300042605 | Bacteria | 1302 |
| 40 | Ga0466719_186826 | 3300042606 | Bacteria | 4319 |
| 41 | Ga0466722_124305 | 3300042609 | Bacteria | 15678 |
| 42 | Ga0264413_111305 | 3300024493 | Bacteria | 10078 |
| 43 | Ga0466690_187421 | 3300042590 | Bacteria | 9241 |
| 44 | Ga0466694_175403 | 3300042594 | Bacteria | 1842 |
| 45 | Ga0466694_255708 | 3300042594 | Bacteria | 1435 |
| 46 | Ga0466696_187516 | 3300042596 | Bacteria | 1921 |
| 47 | Ga0466699_121589 | 3300042597 | Bacteria | 3191 |
| 48 | AustNasuHG_c1003409 | 3300000089 | Bacteria | 5740 |
| 49 | AustNasuHG_c1003940 | 3300000089 | Bacteria | 5346 |
| 50 | JGI24698J34947_10012280 | 3300002449 | Unclassified | 4694 |
| 51 | JGI24695J34938_10005518 | 3300002450 | Bacteria | 7860 |
| 52 | JGI24702J35022_10028460 | 3300002462 | Bacteria | 3003 |
| 53 | Ga0466705_436754 | 3300042612 | Bacteria | 3181 |
| 54 | Ga0466712_042156 | 3300042614 | Bacteria | 1797 |
| 55 | Ga0466712_111075 | 3300042614 | Bacteria | 1299 |
| 56 | Ga0466712_137964 | 3300042614 | Bacteria | 6452 |
| 57 | Ga0466712_314821 | 3300042614 | Bacteria | 22070 |
| 58 | Ga0466715_005737 | 3300042616 | Bacteria | 7702 |
| 59 | Ga0466723_010046 | 3300042618 | Bacteria | 9266 |
| 60 | Ga0466726_011810 | 3300042619 | Bacteria | 4737 |
| 61 | Ga0466726_303108 | 3300042619 | Bacteria | 2267 |
| 62 | Ga0466705_367487 | 3300042612 | Bacteria | 5768 |
| 63 | Ga0466733_062653 | 3300042659 | Bacteria | 8413 |
| 64 | Ga0466729_272463 | 3300042621 | Bacteria | 1940 |
| 65 | Ga0466735_200210 | 3300042624 | Bacteria | 11406 |
| 66 | Ga0466703_078118 | 3300042636 | Bacteria | 8769 |
| 67 | Ga0466709_072387 | 3300042648 | Bacteria | 7493 |
| 68 | Ga0466709_115105 | 3300042648 | Bacteria | 20186 |
| 69 | Ga0466709_268374 | 3300042648 | Bacteria | 17073 |
| 70 | Ga0466708_030886 | 3300042652 | Bacteria | 29315 |
| 71 | Ga0466727_115315 | 3300042655 | Bacteria | 1134 |
| 72 | Ga0466727_182188 | 3300042655 | Bacteria | 6726 |
| 73 | Ga0466727_216570 | 3300042655 | Bacteria | 2740 |
| 74 | Ga0466727_297475 | 3300042655 | Bacteria | 2023 |
| 75 | Ga0466700_480759 | 3300042600 | Bacteria | 1311 |
| 76 | Ga0466707_382514 | 3300042601 | Bacteria | 2311 |
| 77 | Ga0466722_070996 | 3300042609 | Bacteria | 1753 |
| 78 | Ga0466698_173335 | 3300042610 | Bacteria | 5027 |
| 79 | Ga0264413_114977 | 3300024493 | Bacteria | 37616 |
| 80 | Ga0264413_123879 | 3300024493 | Bacteria | 4015 |
| 81 | Ga0466694_047458 | 3300042594 | Bacteria | 1777 |
| 82 | Ga0466696_010997 | 3300042596 | Bacteria | 3213 |
| 83 | Ga0466696_504783 | 3300042596 | Bacteria | 7015 |
| 84 | JGI24698J34947_10100828 | 3300002449 | Unclassified | 1299 |
| 85 | JGI24698J34947_10244822 | 3300002449 | Unclassified | 673 |
| 86 | Ga0068302_10206038 | 3300005071 | Bacteria | 1052 |
| 87 | Ga0072941_1032758 | 3300005201 | Bacteria | 9046 |
| 88 | Ga0466712_095336 | 3300042614 | Bacteria | 1086 |
| 89 | Ga0466715_608467 | 3300042616 | Bacteria | 2978 |
| 90 | Ga0466718_005933 | 3300042617 | Bacteria | 1999 |
| 91 | Ga0466718_078022 | 3300042617 | Bacteria | 5978 |
| 92 | Ga0466718_112506 | 3300042617 | Bacteria | 2234 |
| 93 | Ga0466723_344469 | 3300042618 | Bacteria | 1370 |
| 94 | Ga0466728_359443 | 3300042620 | Unclassified | 1705 |
| 95 | Ga0466729_167829 | 3300042621 | Bacteria | 1040 |
| 96 | Ga0466705_145282 | 3300042612 | Bacteria | 3546 |
| 97 | Ga0466733_186342 | 3300042659 | Bacteria | 6645 |
| 98 | Ga0466702_061015 | 3300042635 | Bacteria | 11994 |
| 99 | Ga0466702_242660 | 3300042635 | Bacteria | 2203 |
| 100 | Ga0466703_087570 | 3300042636 | Bacteria | 12668 |
| 101 | Ga0466703_353872 | 3300042636 | Bacteria | 3170 |
| 102 | Ga0466704_198334 | 3300042643 | Bacteria | 7813 |
| 103 | Ga0466709_413387 | 3300042648 | Bacteria | 46907 |
| 104 | Ga0466727_298448 | 3300042655 | Unclassified | 1913 |
| 105 | Ga0466722_133431 | 3300042609 | Bacteria | 11978 |
| 106 | Ga0123353_10177004 | 3300010167 | Bacteria | 3381 |
| 107 | Ga0466690_391710 | 3300042590 | Unclassified | 1557 |
| 108 | Ga0466694_091707 | 3300042594 | Bacteria | 2331 |
| 109 | Ga0466694_140325 | 3300042594 | Bacteria | 2774 |
| 110 | Ga0466696_072540 | 3300042596 | Bacteria | 3078 |
| 111 | Ga0466699_241295 | 3300042597 | Bacteria | 39977 |
| 112 | JGI24698J34947_10011218 | 3300002449 | Bacteria | 4920 |
| 113 | JGI24698J34947_10075915 | 3300002449 | Unclassified | 1595 |
| 114 | Ga0466712_026369 | 3300042614 | Bacteria | 22902 |
| 115 | Ga0466712_050058 | 3300042614 | Bacteria | 14359 |
| 116 | Ga0466712_163032 | 3300042614 | Bacteria | 2442 |
| 117 | Ga0466711_009499 | 3300042615 | Bacteria | 6762 |
| 118 | Ga0466723_008601 | 3300042618 | Bacteria | 6333 |
| 119 | Ga0466723_236614 | 3300042618 | Bacteria | 13564 |
| 120 | Ga0466728_075994 | 3300042620 | Bacteria | 11940 |
| 121 | Ga0466728_183946 | 3300042620 | Bacteria | 1954 |
| 122 | Ga0466732_042363 | 3300042656 | Bacteria | 5548 |
| 123 | Ga0466735_122681 | 3300042624 | Bacteria | 1528 |
| 124 | Ga0466735_148334 | 3300042624 | Bacteria | 1594 |
| 125 | Ga0466735_171313 | 3300042624 | Bacteria | 1372 |
| 126 | Ga0466703_014697 | 3300042636 | Bacteria | 4446 |
| 127 | Ga0466703_181843 | 3300042636 | Bacteria | 19891 |
| 128 | Ga0466703_250203 | 3300042636 | Bacteria | 1227 |
| 129 | Ga0466704_160887 | 3300042643 | Bacteria | 35133 |
| 130 | Ga0466704_213853 | 3300042643 | Bacteria | 1400 |
| 131 | Ga0466704_249894 | 3300042643 | Bacteria | 2102 |
| 132 | Ga0466704_478677 | 3300042643 | Bacteria | 2277 |
| 133 | Ga0466709_103841 | 3300042648 | Bacteria | 3170 |
| 134 | Ga0466708_085463 | 3300042652 | Bacteria | 4732 |
| 135 | Ga0466708_274324 | 3300042652 | Bacteria | 6634 |
| 136 | Ga0466727_149631 | 3300042655 | Bacteria | 1313 |
| 137 | Ga0466700_105661 | 3300042600 | Bacteria | 2313 |
| 138 | Ga0466722_150118 | 3300042609 | Bacteria | 2476 |
| 139 | Ga0466722_264250 | 3300042609 | Bacteria | 3082 |
| 140 | Ga0123356_10111793 | 3300010049 | Bacteria | 2640 |
| 141 | Ga0264413_127023 | 3300024493 | Bacteria | 3738 |
| 142 | Ga0466696_285049 | 3300042596 | Unclassified | 2963 |
| 143 | Ga0466699_057682 | 3300042597 | Bacteria | 7503 |
| 144 | Ga0466699_195892 | 3300042597 | Bacteria | 4943 |
| 145 | AustNasuHG_c1012319 | 3300000089 | Bacteria | 2952 |
| 146 | AustNasuHG_c1016515 | 3300000089 | Bacteria | 2469 |
| 147 | JGI24698J34947_10012527 | 3300002449 | Bacteria | 4648 |
| 148 | JGI24698J34947_10014435 | 3300002449 | Unclassified | 4301 |
| 149 | Ga0466712_084704 | 3300042614 | Bacteria | 2775 |
| 150 | Ga0466712_115219 | 3300042614 | Bacteria | 9313 |
| 151 | Ga0466712_117794 | 3300042614 | Unclassified | 1642 |
| 152 | Ga0466712_266927 | 3300042614 | Bacteria | 2240 |
| 153 | Ga0466715_131677 | 3300042616 | Bacteria | 7514 |
| 154 | Ga0466705_054552 | 3300042612 | Bacteria | 6774 |
| 155 | Ga0466732_436055 | 3300042656 | Bacteria | 3419 |
| 156 | Ga0466735_041291 | 3300042624 | Bacteria | 14490 |
| 157 | Ga0466735_176780 | 3300042624 | Bacteria | 1732 |
| 158 | Ga0466702_466217 | 3300042635 | Bacteria | 13914 |
| 159 | Ga0466703_006760 | 3300042636 | Bacteria | 1714 |
| 160 | Ga0466704_105034 | 3300042643 | Bacteria | 26595 |
| 161 | Ga0466704_477804 | 3300042643 | Unclassified | 2414 |
| 162 | Ga0466727_312946 | 3300042655 | Bacteria | 3646 |
| 163 | Ga0466706_193767 | 3300042599 | Bacteria | 1063 |
| 164 | Ga0466719_173927 | 3300042606 | Bacteria | 8430 |
| 165 | Ga0466719_465998 | 3300042606 | Bacteria | 6863 |
| 166 | Ga0466720_071296 | 3300042607 | Bacteria | 1872 |
| 167 | Ga0466720_090063 | 3300042607 | Bacteria | 5155 |
| 168 | Ga0466698_184485 | 3300042610 | Bacteria | 1430 |
| 169 | Ga0264413_105646 | 3300024493 | Bacteria | 11070 |
| 170 | Ga0466657_334716 | 3300042582 | Bacteria | 1113 |
| 171 | Ga0466691_068316 | 3300042593 | Bacteria | 35532 |
| 172 | Ga0466696_115032 | 3300042596 | Bacteria | 9868 |
| 173 | Ga0466696_420292 | 3300042596 | Bacteria | 4914 |
| 174 | Ga0466699_060212 | 3300042597 | Bacteria | 1636 |
| 175 | Ga0466699_066651 | 3300042597 | Bacteria | 26757 |
| 176 | Ga0466699_237511 | 3300042597 | Bacteria | 7226 |
| 177 | AustNasuHG_c1000705 | 3300000089 | Bacteria | 11869 |
| 178 | JGI24698J34947_10062041 | 3300002449 | Bacteria | 1837 |
| 179 | JGI24695J34938_10028148 | 3300002450 | Bacteria | 2644 |
| 180 | Ga0072941_1002586 | 3300005201 | Bacteria | 28794 |
| 181 | Ga0466712_310000 | 3300042614 | Unclassified | 2334 |
| 182 | Ga0466711_169796 | 3300042615 | Bacteria | 7812 |
| 183 | Ga0466715_135985 | 3300042616 | Bacteria | 10199 |
| 184 | Ga0466718_040204 | 3300042617 | Bacteria | 13075 |
| 185 | Ga0466718_120902 | 3300042617 | Bacteria | 4380 |
| 186 | Ga0466723_270493 | 3300042618 | Archaea | 1518 |
| 187 | Ga0466726_118347 | 3300042619 | Bacteria | 1511 |
| 188 | Ga0466726_378794 | 3300042619 | Bacteria | 1799 |
| 189 | Ga0466729_136360 | 3300042621 | Bacteria | 2151 |
| 190 | Ga0466729_223348 | 3300042621 | Bacteria | 1317 |
| 191 | Ga0466702_141111 | 3300042635 | Bacteria | 1741 |
| 192 | Ga0466704_167275 | 3300042643 | Bacteria | 18865 |
| 193 | Ga0466704_186409 | 3300042643 | Bacteria | 7009 |
| 194 | Ga0466708_033702 | 3300042652 | Bacteria | 62053 |
| 195 | Ga0466708_162073 | 3300042652 | Bacteria | 3131 |
| 196 | Ga0466708_374227 | 3300042652 | Bacteria | 7691 |
| 197 | Ga0466727_160044 | 3300042655 | Bacteria | 2864 |
| 198 | Ga0466717_182537 | 3300042604 | Bacteria | 1558 |
| 199 | Ga0466719_003736 | 3300042606 | Bacteria | 2276 |
| 200 | Ga0466719_054790 | 3300042606 | Bacteria | 6685 |
| 201 | Ga0466722_077367 | 3300042609 | Bacteria | 3378 |
| 202 | Ga0466722_223078 | 3300042609 | Bacteria | 7680 |
| 203 | Ga0466698_118646 | 3300042610 | Bacteria | 1594 |
| 204 | Ga0123356_10047107 | 3300010049 | Bacteria | 4011 |
| 205 | Ga0123356_13791549 | 3300010049 | Bacteria | 522 |
| 206 | Ga0264413_111977 | 3300024493 | Bacteria | 3488 |
| 207 | Ga0466690_024208 | 3300042590 | Bacteria | 5231 |
| 208 | Ga0466690_290907 | 3300042590 | Bacteria | 2774 |
| 209 | Ga0466691_034660 | 3300042593 | Bacteria | 57357 |
| 210 | Ga0466691_132996 | 3300042593 | Bacteria | 31181 |
| 211 | Ga0466696_133724 | 3300042596 | Bacteria | 4419 |
| 212 | Ga0466696_280411 | 3300042596 | Bacteria | 2977 |
| 213 | Ga0466696_326358 | 3300042596 | Bacteria | 2112 |
| 214 | Ga0466699_336850 | 3300042597 | Bacteria | 1404 |
| 215 | JGI24698J34947_10130944 | 3300002449 | Bacteria | 1072 |
| 216 | Ga0466712_317612 | 3300042614 | Bacteria | 15050 |
| 217 | Ga0466711_183178 | 3300042615 | Bacteria | 53190 |
| 218 | Ga0466711_382264 | 3300042615 | Bacteria | 3410 |
| 219 | Ga0466711_437522 | 3300042615 | Bacteria | 3794 |
| 220 | Ga0466723_367134 | 3300042618 | Bacteria | 3264 |
| 221 | Ga0466726_000292 | 3300042619 | Unclassified | 1793 |
| 222 | Ga0466726_140868 | 3300042619 | Bacteria | 5592 |
| 223 | Ga0466726_319532 | 3300042619 | Bacteria | 1075 |
| 224 | Ga0466728_235556 | 3300042620 | Bacteria | 1895 |
| 225 | Ga0466705_100426 | 3300042612 | Bacteria | 5469 |
| 226 | Ga0466705_207771 | 3300042612 | Bacteria | 19716 |
| 227 | Ga0466705_279322 | 3300042612 | Bacteria | 5569 |
| 228 | Ga0466702_424422 | 3300042635 | Bacteria | 2308 |
| 229 | Ga0466703_068928 | 3300042636 | Bacteria | 3566 |
| 230 | Ga0466703_135203 | 3300042636 | Bacteria | 13481 |
| 231 | Ga0466704_482889 | 3300042643 | Bacteria | 3803 |
| 232 | Ga0466709_280308 | 3300042648 | Bacteria | 1222 |
| 233 | Ga0466708_108525 | 3300042652 | Bacteria | 5596 |
| 234 | Ga0466707_052383 | 3300042601 | Bacteria | 1198 |
| 235 | Ga0466707_055314 | 3300042601 | Bacteria | 1464 |
| 236 | Ga0466707_096755 | 3300042601 | Bacteria | 1562 |
| 237 | Ga0466707_155494 | 3300042601 | Bacteria | 1090 |
| 238 | Ga0466716_217351 | 3300042605 | Bacteria | 1968 |
| 239 | Ga0466716_273356 | 3300042605 | Bacteria | 11654 |
| 240 | Ga0466719_387641 | 3300042606 | Bacteria | 24206 |
| 241 | Ga0466720_225402 | 3300042607 | Unclassified | 1497 |
| 242 | Ga0466698_200169 | 3300042610 | Bacteria | 1462 |
| 243 | Ga0466698_282566 | 3300042610 | Bacteria | 2150 |
| 244 | Ga0466698_443706 | 3300042610 | Bacteria | 1954 |
| 245 | Ga0466690_344470 | 3300042590 | Bacteria | 2737 |
| 246 | Ga0466690_399771 | 3300042590 | Bacteria | 1034 |
| 247 | Ga0466691_128859 | 3300042593 | Bacteria | 17080 |
| 248 | Ga0466694_042213 | 3300042594 | Bacteria | 1617 |
| 249 | Ga0466694_100362 | 3300042594 | Bacteria | 4199 |
| 250 | Ga0466696_135562 | 3300042596 | Bacteria | 33885 |
| 251 | Ga0466699_290091 | 3300042597 | Bacteria | 4677 |
| 252 | JGI24698J34947_10005662 | 3300002449 | Bacteria | 6850 |
| 253 | JGI24698J34947_10006024 | 3300002449 | Bacteria | 6658 |
| 254 | JGI24698J34947_10013839 | 3300002449 | Unclassified | 4398 |
| 255 | JGI24698J34947_10169050 | 3300002449 | Bacteria | 887 |
| 256 | JGI24698J34947_10201267 | 3300002449 | Bacteria | 779 |
| 257 | Ga0068302_10600066 | 3300005071 | Bacteria | 1061 |
| 258 | Ga0072940_1056179 | 3300005200 | Bacteria | 5772 |
| 259 | Ga0466712_060585 | 3300042614 | Bacteria | 4826 |
| 260 | Ga0466711_039518 | 3300042615 | Bacteria | 6447 |
| 261 | Ga0466711_371364 | 3300042615 | Bacteria | 2111 |
| 262 | Ga0466715_512447 | 3300042616 | Bacteria | 9314 |
| 263 | Ga0466718_006444 | 3300042617 | Bacteria | 75149 |
| 264 | Ga0466723_029160 | 3300042618 | Bacteria | 8659 |
| 265 | Ga0466723_187521 | 3300042618 | Bacteria | 1618 |
| 266 | Ga0466728_078000 | 3300042620 | Bacteria | 3397 |
| 267 | Ga0466729_186069 | 3300042621 | Bacteria | 2289 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF04519 | Bactofilin | Polymer-forming cytoskeletal | 43 | 140 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.