Protein Family IF06915
Metagenome
Isolate
148
Members
47
Samples
141
Scaffolds
344.73
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_254353|Ga0466722_254353_1394_2614
- Length
- 406 aa
- Sequence
- VNRFDFLPLLPPACAKYLKSMLTLFQKVFRFIMTKIYILSFLLSGHPRKPAWRGQRTGGRGAMAIEIIATGRAIPPRRVTNDDLAARIDTTDEWIRSHTGIGARHIAEADVAASDLALEAANNALSLAIERGAVTEKSIEELALTIDLIVLGTTTQDYYGCPATACIVQDKLGAYNAGAMDITVACSSFVYGLEAAAGLLTVSPERKRALVIGAETLSRIADWNDRSICVLFGDGAGAVLIEKTGAPAVGPGRRGLVRSVLGADGSGAQALIVRRGGGRNPLSAGEILDRAPGIEMDGQAVYRFAVAAVTGTIEKLLLYEGITISDIDRIVPHQANARIVQAAGKRLGINEEKFYLNIEEYANTSSASIPIALDELNRAEKLRRGDVVMTVGFGAGLTYGGNLIIW
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.6%
Kalotermitidae
31.1%
Unclassified
20.0%
Termopsidae
6.7%
Rhinotermitidae
6.7%
Taxonomy
Archaea
0
Bacteria
145
Eukaryota
0
Viruses
0
Unclassified
3
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125685 | Treponema sp. Lab288P1bin13 | Isolate | Unclassified |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 10 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 11 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 12 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 13 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 14 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 15 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 16 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 17 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 18 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 19 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 20 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 21 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 22 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 23 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 24 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 25 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 26 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 27 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 28 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 29 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 30 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 31 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 32 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 33 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 34 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 35 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 36 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 37 | 2781125686 | Treponema sp. Lab288P4bin22 | Isolate | Unclassified |
| 38 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 39 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 40 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 41 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 42 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 43 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 44 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 45 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 46 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 47 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_019501 | 3300042659 | Bacteria | 21602 |
| 2 | Ga0456237_0002024 | 3300041968 | Bacteria | 3274 |
| 3 | Ga0466690_014585 | 3300042590 | Bacteria | 4703 |
| 4 | Ga0466690_207404 | 3300042590 | Bacteria | 3193 |
| 5 | Ga0466691_002246 | 3300042593 | Bacteria | 7226 |
| 6 | Ga0466691_013193 | 3300042593 | Bacteria | 17542 |
| 7 | Ga0466694_373505 | 3300042594 | Bacteria | 3081 |
| 8 | Ga0466711_241704 | 3300042615 | Bacteria | 15416 |
| 9 | AustNasuHG_c1008623 | 3300000089 | Bacteria | 3607 |
| 10 | Ga0072940_1012311 | 3300005200 | Bacteria | 3230 |
| 11 | Ga0466703_157496 | 3300042636 | Bacteria | 1366 |
| 12 | Ga0466703_336614 | 3300042636 | Bacteria | 6835 |
| 13 | Ga0466709_362037 | 3300042648 | Bacteria | 7394 |
| 14 | Ga0466707_400853 | 3300042601 | Bacteria | 2430 |
| 15 | Ga0466722_183400 | 3300042609 | Bacteria | 9904 |
| 16 | Ga0466705_022323 | 3300042612 | Bacteria | 2232 |
| 17 | Ga0466705_056022 | 3300042612 | Bacteria | 2882 |
| 18 | Ga0466733_112678 | 3300042659 | Bacteria | 2140 |
| 19 | Ga0466733_141867 | 3300042659 | Bacteria | 123412 |
| 20 | Ga0123354_10086539 | 3300010882 | Bacteria | 4380 |
| 21 | Ga0456237_0006399 | 3300041968 | Bacteria | 1848 |
| 22 | Ga0466692_159283 | 3300042591 | Bacteria | 3946 |
| 23 | Ga0466691_017213 | 3300042593 | Bacteria | 12816 |
| 24 | Ga0466694_368231 | 3300042594 | Bacteria | 3566 |
| 25 | Ga0466726_355114 | 3300042619 | Bacteria | 22564 |
| 26 | Ga0072941_1001096 | 3300005201 | Bacteria | 35810 |
| 27 | Ga0466704_292852 | 3300042643 | Bacteria | 24612 |
| 28 | Ga0466704_449099 | 3300042643 | Bacteria | 67975 |
| 29 | Ga0466708_018782 | 3300042652 | Bacteria | 2221 |
| 30 | Ga0466708_245252 | 3300042652 | Bacteria | 2146 |
| 31 | Ga0466727_139438 | 3300042655 | Bacteria | 1726 |
| 32 | Ga0466727_332188 | 3300042655 | Bacteria | 29400 |
| 33 | Ga0466719_002776 | 3300042606 | Bacteria | 1609 |
| 34 | Ga0466705_163188 | 3300042612 | Bacteria | 8054 |
| 35 | Ga0466691_129158 | 3300042593 | Bacteria | 30130 |
| 36 | Ga0466696_083696 | 3300042596 | Bacteria | 32412 |
| 37 | Ga0466711_083245 | 3300042615 | Bacteria | 1929 |
| 38 | Ga0466715_217968 | 3300042616 | Bacteria | 21229 |
| 39 | Ga0466723_148232 | 3300042618 | Bacteria | 7514 |
| 40 | Ga0466728_134017 | 3300042620 | Bacteria | 5815 |
| 41 | Ga0466704_113543 | 3300042643 | Bacteria | 47006 |
| 42 | Ga0466716_047820 | 3300042605 | Bacteria | 3574 |
| 43 | Ga0466720_067212 | 3300042607 | Bacteria | 6814 |
| 44 | Ga0466722_033216 | 3300042609 | Bacteria | 2211 |
| 45 | Ga0466705_034182 | 3300042612 | Unclassified | 8587 |
| 46 | Ga0466705_306326 | 3300042612 | Bacteria | 7918 |
| 47 | Ga0466732_430379 | 3300042656 | Bacteria | 2354 |
| 48 | Ga0123353_10276674 | 3300010167 | Bacteria | 2581 |
| 49 | Ga0123353_10449098 | 3300010167 | Bacteria | 1899 |
| 50 | Ga0264413_131113 | 3300024493 | Bacteria | 3156 |
| 51 | Ga0466696_167460 | 3300042596 | Bacteria | 2263 |
| 52 | Ga0466711_285988 | 3300042615 | Bacteria | 4124 |
| 53 | Ga0466728_027754 | 3300042620 | Bacteria | 2582 |
| 54 | AustNasuHG_c1000622 | 3300000089 | Bacteria | 12543 |
| 55 | Ga0072940_1050518 | 3300005200 | Bacteria | 4106 |
| 56 | Ga0072941_1001095 | 3300005201 | Bacteria | 13049 |
| 57 | Ga0466735_024280 | 3300042624 | Bacteria | 10134 |
| 58 | Ga0466703_177637 | 3300042636 | Bacteria | 197398 |
| 59 | Ga0466703_341512 | 3300042636 | Bacteria | 3346 |
| 60 | Ga0466704_083248 | 3300042643 | Bacteria | 1395 |
| 61 | Ga0466704_283971 | 3300042643 | Bacteria | 1613 |
| 62 | Ga0466708_087612 | 3300042652 | Bacteria | 5602 |
| 63 | Ga0466727_129071 | 3300042655 | Bacteria | 5069 |
| 64 | Ga0466707_036814 | 3300042601 | Bacteria | 1226 |
| 65 | Ga0466716_020630 | 3300042605 | Bacteria | 6725 |
| 66 | Ga0466716_359429 | 3300042605 | Bacteria | 9631 |
| 67 | Ga0466720_053995 | 3300042607 | Bacteria | 3446 |
| 68 | Ga0466722_055897 | 3300042609 | Bacteria | 3161 |
| 69 | Ga0466698_215245 | 3300042610 | Bacteria | 4356 |
| 70 | Ga0466696_017753 | 3300042596 | Bacteria | 6503 |
| 71 | Ga0466699_299668 | 3300042597 | Bacteria | 1424 |
| 72 | Ga0466699_317895 | 3300042597 | Bacteria | 2291 |
| 73 | Ga0466715_413880 | 3300042616 | Bacteria | 3482 |
| 74 | JGI24702J35022_10015485 | 3300002462 | Bacteria | 4196 |
| 75 | JGI24702J35022_10063631 | 3300002462 | Bacteria | 1977 |
| 76 | JGI24702J35022_10109825 | 3300002462 | Bacteria | 1516 |
| 77 | Ga0068305_10132018 | 3300005083 | Bacteria | 17470 |
| 78 | Ga0072940_1064735 | 3300005200 | Bacteria | 5643 |
| 79 | Ga0072941_1001094 | 3300005201 | Bacteria | 56271 |
| 80 | Ga0466703_205642 | 3300042636 | Bacteria | 23905 |
| 81 | Ga0466704_043323 | 3300042643 | Bacteria | 77338 |
| 82 | Ga0466704_340515 | 3300042643 | Bacteria | 4814 |
| 83 | Ga0466709_032203 | 3300042648 | Bacteria | 3164 |
| 84 | Ga0466727_230491 | 3300042655 | Bacteria | 44965 |
| 85 | Ga0466707_082803 | 3300042601 | Bacteria | 1340 |
| 86 | Ga0466722_151471 | 3300042609 | Bacteria | 5349 |
| 87 | Ga0466722_254353 | 3300042609 | Bacteria | 4371 |
| 88 | Ga0466705_016129 | 3300042612 | Bacteria | 11821 |
| 89 | Ga0466705_133917 | 3300042612 | Bacteria | 2593 |
| 90 | Ga0466705_284683 | 3300042612 | Bacteria | 6547 |
| 91 | Ga0466733_125796 | 3300042659 | Bacteria | 3093 |
| 92 | Ga0123354_10023356 | 3300010882 | Bacteria | 9753 |
| 93 | Ga0466690_106666 | 3300042590 | Bacteria | 2928 |
| 94 | Ga0466692_099962 | 3300042591 | Bacteria | 5697 |
| 95 | Ga0466693_255896 | 3300042592 | Bacteria | 4273 |
| 96 | Ga0466691_225951 | 3300042593 | Bacteria | 7850 |
| 97 | Ga0466699_028523 | 3300042597 | Bacteria | 23057 |
| 98 | Ga0466715_054701 | 3300042616 | Bacteria | 2481 |
| 99 | Ga0466723_264860 | 3300042618 | Bacteria | 3003 |
| 100 | JGI24698J34947_10000882 | 3300002449 | Bacteria | 15178 |
| 101 | Ga0466735_038450 | 3300042624 | Bacteria | 5059 |
| 102 | Ga0466703_048664 | 3300042636 | Bacteria | 11042 |
| 103 | Ga0466704_339474 | 3300042643 | Bacteria | 18180 |
| 104 | Ga0466713_041904 | 3300042602 | Bacteria | 4287 |
| 105 | Ga0466719_380576 | 3300042606 | Unclassified | 1493 |
| 106 | Ga0466720_076911 | 3300042607 | Bacteria | 1354 |
| 107 | Ga0466720_210719 | 3300042607 | Bacteria | 2002 |
| 108 | Ga0466732_075496 | 3300042656 | Bacteria | 2434 |
| 109 | Ga0466732_164865 | 3300042656 | Bacteria | 1677 |
| 110 | Ga0415639_008352 | 3300038395 | Bacteria | 5892 |
| 111 | Ga0466690_392329 | 3300042590 | Bacteria | 2327 |
| 112 | Ga0466695_106127 | 3300042595 | Bacteria | 4413 |
| 113 | Ga0466705_497425 | 3300042612 | Bacteria | 6020 |
| 114 | Ga0466715_449231 | 3300042616 | Bacteria | 13036 |
| 115 | Ga0466726_069480 | 3300042619 | Bacteria | 23044 |
| 116 | Ga0466726_162096 | 3300042619 | Bacteria | 1520 |
| 117 | Ga0466728_109346 | 3300042620 | Bacteria | 2608 |
| 118 | Ga0466728_365193 | 3300042620 | Bacteria | 9580 |
| 119 | Ga0466735_119287 | 3300042624 | Unclassified | 1451 |
| 120 | Ga0466709_408723 | 3300042648 | Bacteria | 2866 |
| 121 | Ga0466716_293854 | 3300042605 | Bacteria | 8099 |
| 122 | Ga0466719_118394 | 3300042606 | Bacteria | 2808 |
| 123 | Ga0466722_106030 | 3300042609 | Bacteria | 7219 |
| 124 | Ga0466722_224143 | 3300042609 | Bacteria | 2271 |
| 125 | Ga0466705_047043 | 3300042612 | Bacteria | 38569 |
| 126 | Ga0466705_054731 | 3300042612 | Bacteria | 1633 |
| 127 | Ga0123353_10011959 | 3300010167 | Bacteria | 12280 |
| 128 | Ga0466691_060086 | 3300042593 | Bacteria | 24330 |
| 129 | Ga0466723_045433 | 3300042618 | Bacteria | 14123 |
| 130 | Ga0466723_096958 | 3300042618 | Bacteria | 15636 |
| 131 | Ga0466726_374281 | 3300042619 | Bacteria | 1527 |
| 132 | Ga0072941_1040142 | 3300005201 | Bacteria | 5805 |
| 133 | Ga0466703_021465 | 3300042636 | Bacteria | 13133 |
| 134 | Ga0466703_201089 | 3300042636 | Bacteria | 5196 |
| 135 | Ga0466703_243942 | 3300042636 | Bacteria | 5937 |
| 136 | Ga0466704_029582 | 3300042643 | Bacteria | 40583 |
| 137 | Ga0466709_044014 | 3300042648 | Bacteria | 5647 |
| 138 | Ga0466709_050803 | 3300042648 | Bacteria | 6568 |
| 139 | Ga0466717_125711 | 3300042604 | Bacteria | 2188 |
| 140 | Ga0466719_179269 | 3300042606 | Bacteria | 7064 |
| 141 | Ga0466719_534081 | 3300042606 | Bacteria | 1739 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.