Protein Family IF06911
Metagenome
Isolate
112
Members
43
Samples
104
Scaffolds
445.89
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_248683|Ga0466722_248683_2674_4128
- Length
- 473 aa
- Sequence
- MIFRSFPQENEKNNRASLIRVNLISGALKKVHMTKEQAGRLIREYAEIVNAHDTIDNELYTKYEVKRGLRDISGKGVLVGLTEISEIFSFILENGDYIPCEGKLYYRGINIEKIVQGFIDENRFGFEEVCFLLLFGYLPKTGEYEEFSALVRDTIMNAPSKDMMNSLARSVLTLYAYDDNPDDTSIANVIRQSIRLIAQFPLLAIYGYQSYVHFHSNQSLVIHPPQKGLAIAENILYMLRPDSSYTKLEAQILDLALVLHAEHGGGNNSTFTTHVVSSSHTDTYSSVAASLGSLKGPRHGGANIKVMQMFRDMQVKIDDWDDDDEISAYLEKLLTKEAFDGSGLIYGMGHAVYSLSDPRALVFRRFVEQLASEKKRQEEYKLYSKVEYLAPQAIAKLRKIYKGVSANVDFYSGFVYSMLDLPEELYTPLFAIARLAGWSAHRIEELVNNGKIIRPAYKSVSKRAAYVPLKDRG
Sample Types
Isolate
7.1%
Metagenome
92.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.0%
Kalotermitidae
32.5%
Unclassified
20.0%
Rhinotermitidae
7.5%
Termopsidae
5.0%
Taxonomy
Archaea
1
Bacteria
109
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2820641689 | Unclassified Firmicutes Cu122P5bin5 | Isolate | Unclassified |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 4 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 7 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 8 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 9 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 10 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 11 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 14 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 15 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 18 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 19 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 20 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 21 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 22 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 23 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 24 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 25 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 26 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 27 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 28 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 29 | 2781125637 | Treponema sp. Co191P1bin9 | Isolate | Unclassified |
| 30 | 2781125641 | Treponema sp. Co191P1bin27 | Isolate | Unclassified |
| 31 | 2529293168 | Ruminiclostridium cellobioparum termitidis CT1112 | Isolate | Termitidae |
| 32 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 33 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 34 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 35 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 36 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 37 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 38 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 39 | 2781125693 | Treponema sp. Th196P3bin148 | Isolate | Unclassified |
| 40 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_102820 | 3300024493 | Bacteria | 21633 |
| 2 | Ga0466690_416518 | 3300042590 | Bacteria | 4165 |
| 3 | Ga0466691_024026 | 3300042593 | Bacteria | 26394 |
| 4 | Ga0466715_067344 | 3300042616 | Bacteria | 12599 |
| 5 | Ga0466715_422010 | 3300042616 | Bacteria | 1606 |
| 6 | Ga0466716_067836 | 3300042605 | Bacteria | 32331 |
| 7 | Ga0123356_10155639 | 3300010049 | Bacteria | 2276 |
| 8 | Ga0466704_332185 | 3300042643 | Bacteria | 9704 |
| 9 | Ga0466708_124460 | 3300042652 | Bacteria | 32824 |
| 10 | JGI24698J34947_10000070 | 3300002449 | Bacteria | 32603 |
| 11 | JGI24695J34938_10000459 | 3300002450 | Bacteria | 39605 |
| 12 | JGI24695J34938_10000684 | 3300002450 | Bacteria | 32005 |
| 13 | JGI24695J34938_10000983 | 3300002450 | Bacteria | 25897 |
| 14 | Ga0466694_235800 | 3300042594 | Bacteria | 4172 |
| 15 | Ga0466699_098183 | 3300042597 | Bacteria | 1622 |
| 16 | Ga0466723_159389 | 3300042618 | Bacteria | 2125 |
| 17 | Ga0466726_368293 | 3300042619 | Bacteria | 15208 |
| 18 | Ga0466726_431689 | 3300042619 | Bacteria | 5470 |
| 19 | Ga0466728_005738 | 3300042620 | Bacteria | 1896 |
| 20 | Ga0466714_031870 | 3300042603 | Bacteria | 2252 |
| 21 | Ga0466717_075763 | 3300042604 | Bacteria | 1328 |
| 22 | Ga0466709_377154 | 3300042648 | Bacteria | 6395 |
| 23 | JGI24698J34947_10007024 | 3300002449 | Bacteria | 6189 |
| 24 | JGI24695J34938_10006962 | 3300002450 | Bacteria | 6709 |
| 25 | JGI24695J34938_10019065 | 3300002450 | Bacteria | 3410 |
| 26 | JGI24695J34938_10020032 | 3300002450 | Bacteria | 3300 |
| 27 | Ga0466694_247086 | 3300042594 | Bacteria | 13485 |
| 28 | Ga0466699_250841 | 3300042597 | Bacteria | 13968 |
| 29 | Ga0466729_190295 | 3300042621 | Bacteria | 1584 |
| 30 | Ga0466700_201535 | 3300042600 | Bacteria | 2824 |
| 31 | Ga0466707_145321 | 3300042601 | Bacteria | 1494 |
| 32 | Ga0466716_476628 | 3300042605 | Bacteria | 3153 |
| 33 | Ga0466719_169635 | 3300042606 | Bacteria | 10571 |
| 34 | Ga0466722_016221 | 3300042609 | Bacteria | 2585 |
| 35 | Ga0466698_075992 | 3300042610 | Bacteria | 12007 |
| 36 | Ga0466698_166156 | 3300042610 | Bacteria | 1711 |
| 37 | Ga0466709_339533 | 3300042648 | Bacteria | 4549 |
| 38 | AustNasuHG_c1002131 | 3300000089 | Bacteria | 7150 |
| 39 | JGI24698J34947_10022505 | 3300002449 | Bacteria | 3380 |
| 40 | JGI24698J34947_10062318 | 3300002449 | Bacteria | 1831 |
| 41 | JGI24695J34938_10006691 | 3300002450 | Bacteria | 6868 |
| 42 | Ga0072941_1002281 | 3300005201 | Bacteria | 9679 |
| 43 | Ga0466696_171751 | 3300042596 | Bacteria | 13390 |
| 44 | Ga0466711_058977 | 3300042615 | Bacteria | 5372 |
| 45 | Ga0466715_569120 | 3300042616 | Bacteria | 11999 |
| 46 | Ga0466718_160217 | 3300042617 | Bacteria | 1626 |
| 47 | Ga0466719_097343 | 3300042606 | Bacteria | 2359 |
| 48 | Ga0466698_387336 | 3300042610 | Bacteria | 2734 |
| 49 | Ga0466703_235040 | 3300042636 | Bacteria | 15046 |
| 50 | Ga0466704_190369 | 3300042643 | Bacteria | 5753 |
| 51 | JGI24695J34938_10000587 | 3300002450 | Bacteria | 35155 |
| 52 | Ga0072941_1004945 | 3300005201 | Bacteria | 7361 |
| 53 | Ga0415639_055020 | 3300038395 | Bacteria | 5512 |
| 54 | Ga0466690_136682 | 3300042590 | Bacteria | 10345 |
| 55 | Ga0466715_219531 | 3300042616 | Bacteria | 4860 |
| 56 | Ga0466715_607081 | 3300042616 | Bacteria | 3049 |
| 57 | Ga0466723_311161 | 3300042618 | Bacteria | 3281 |
| 58 | Ga0466716_211778 | 3300042605 | Bacteria | 7888 |
| 59 | Ga0466719_428362 | 3300042606 | Unclassified | 1655 |
| 60 | Ga0466722_146217 | 3300042609 | Bacteria | 4093 |
| 61 | Ga0123356_10001600 | 3300010049 | Bacteria | 24854 |
| 62 | Ga0123356_10082987 | 3300010049 | Bacteria | 3035 |
| 63 | Ga0466703_025371 | 3300042636 | Bacteria | 12872 |
| 64 | Ga0466727_290968 | 3300042655 | Bacteria | 1945 |
| 65 | JGI24698J34947_10045655 | 3300002449 | Bacteria | 2234 |
| 66 | JGI24695J34938_10006364 | 3300002450 | Bacteria | 7120 |
| 67 | JGI24695J34938_10014874 | 3300002450 | Bacteria | 4012 |
| 68 | JGI24695J34938_10041584 | 3300002450 | Bacteria | 2063 |
| 69 | Ga0466691_085633 | 3300042593 | Bacteria | 11512 |
| 70 | Ga0466696_015549 | 3300042596 | Bacteria | 5940 |
| 71 | Ga0466711_021046 | 3300042615 | Bacteria | 8936 |
| 72 | Ga0466723_045237 | 3300042618 | Bacteria | 2175 |
| 73 | Ga0466707_282842 | 3300042601 | Bacteria | 2432 |
| 74 | Ga0466707_349433 | 3300042601 | Bacteria | 1293 |
| 75 | Ga0466708_022620 | 3300042652 | Bacteria | 37948 |
| 76 | JGI24695J34938_10002133 | 3300002450 | Bacteria | 15451 |
| 77 | JGI24695J34938_10006862 | 3300002450 | Bacteria | 6760 |
| 78 | Ga0456237_0005495 | 3300041968 | Bacteria | 2007 |
| 79 | Ga0466691_142108 | 3300042593 | Bacteria | 6056 |
| 80 | Ga0466699_057566 | 3300042597 | Bacteria | 9052 |
| 81 | Ga0466723_023928 | 3300042618 | Bacteria | 2754 |
| 82 | Ga0466723_101081 | 3300042618 | Bacteria | 10723 |
| 83 | Ga0466728_310395 | 3300042620 | Bacteria | 10693 |
| 84 | Ga0466701_043713 | 3300042598 | Archaea | 1389 |
| 85 | Ga0466716_337682 | 3300042605 | Bacteria | 39319 |
| 86 | Ga0466722_248683 | 3300042609 | Bacteria | 4171 |
| 87 | Ga0466703_221986 | 3300042636 | Bacteria | 3759 |
| 88 | Ga0466708_249621 | 3300042652 | Bacteria | 10071 |
| 89 | Ga0466708_384290 | 3300042652 | Bacteria | 6653 |
| 90 | AustNasuHG_c1001864 | 3300000089 | Bacteria | 7617 |
| 91 | JGI24695J34938_10001773 | 3300002450 | Bacteria | 17816 |
| 92 | JGI24695J34938_10015341 | 3300002450 | Unclassified | 3934 |
| 93 | Ga0466691_019451 | 3300042593 | Bacteria | 33966 |
| 94 | Ga0466691_090347 | 3300042593 | Bacteria | 10907 |
| 95 | Ga0466696_291553 | 3300042596 | Bacteria | 3331 |
| 96 | Ga0466723_006530 | 3300042618 | Bacteria | 22703 |
| 97 | Ga0466728_442989 | 3300042620 | Bacteria | 3069 |
| 98 | Ga0466698_205965 | 3300042610 | Bacteria | 13152 |
| 99 | Ga0123356_10000246 | 3300010049 | Bacteria | 62303 |
| 100 | Ga0466703_004014 | 3300042636 | Bacteria | 2397 |
| 101 | FAAS_10006313 | 3300001880 | Bacteria | 1621 |
| 102 | JGI24698J34947_10015800 | 3300002449 | Bacteria | 4105 |
| 103 | JGI24695J34938_10000844 | 3300002450 | Bacteria | 28443 |
| 104 | JGI24695J34938_10032361 | 3300002450 | Bacteria | 2416 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00285 | Citrate_synt | Citrate synthase, C-terminal domain | 75 | 456 | 0.91 |
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00285 | GO:0046912 | acyltransferase activity, acyl groups converted into alkyl on transfer | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.