Protein Family IF06880

Metagenome Isolate
197 Members
57 Samples
182 Scaffolds
434.88 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_200076|Ga0466722_200076_143_1660
Length
505 aa
Sequence
LVISQVLRFLRLKPYESALDLFNNPVGYFTSLALSQAKALRKCIFNRKEFMKHRFFARVSRTVLALPLTALFFSSCADRGGLVEEAFRVRGAPVLMRELPEEAGGFGSLSFLSKVDITAPQDGVLNRLYFREGDFIRQGALAMRLENPQIKLAVQRAENNFSQAQAACDLSRSRLLEGEFQAEAQLLAIEKAEAELAQARRRWEEDLRKHQHQEALFEAGGIHTEAILSARFSLDSGREQILIMERELDIRHVGCRDRDLAAAGLPIPSGEEERRRSLVSLMTASLRAELGAACARLEAAEKELASARVALEELNLRTPAAGVVGARYFEEGERVRTGDKILTLMDTASLYAIFPLREKDALRVVKGMKALVKIDGTGETREGTVDLVYPQADSQSLSFLVRVLLSSDSADGRTELKPGMFARVAVILGPPRQVLCVPESAVFNKKDGQGSVFVINGSVLSQRRIALGPALGDELEISAGLAAGELVVPRPDAGLREGSNVSLVR

📊 Sample Types

Isolate 7.6%
Metagenome 92.4%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 40.0%
Unclassified 29.1%
Kalotermitidae 23.6%
Rhinotermitidae 3.6%
Termopsidae 3.6%

🌳 Taxonomy

Archaea 1
Bacteria 178
Eukaryota 0
Viruses 1
Unclassified 17

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125629 Treponema sp. Nt197P3bin20 Isolate Unclassified
2 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
3 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
4 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
5 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
6 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
7 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
8 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
9 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
10 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
11 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
12 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
13 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
14 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
15 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
16 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
17 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
18 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
19 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
20 2228664004 P3 Gut Segment Termite Single Cell Genome_Treponema sp. T3b, from Florida USA Metagenome Termitidae
21 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
22 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
23 3300002462 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 Metagenome Termitidae
24 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
25 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
26 3300042595 Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 Metagenome Termitidae
27 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
28 2740892545 Fibrobacteria bacterium GUT31 IN01_31 Isolate Unclassified
29 2781125630 Treponema sp. Nt197P3bin60 Isolate Unclassified
30 2781125657 Treponema sp. Emb289P3bin15 Isolate Unclassified
31 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
32 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
33 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
34 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
35 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
36 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
37 2781125642 Treponema sp. Co191P1bin35 Isolate Unclassified
38 2781125646 Treponema sp. Co191P3bin59 Isolate Unclassified
39 2781125692 Treponema sp. Th196P3bin31 Isolate Unclassified
40 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
41 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
42 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
43 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
44 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
45 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
46 2781125645 Treponema sp. Co191P3bin32 Isolate Unclassified
47 2781125656 Treponema sp. Emb289P1bin65 Isolate Unclassified
48 2781125665 Treponema sp. Emb289P3bin117 Isolate Unclassified
49 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
50 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
51 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
52 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
53 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
54 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
55 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
56 2781125636 Treponema sp. Co191P1bin67 Isolate Unclassified
57 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0123355_10085173 3300009826 Bacteria 5031
2 2230969606 2228664004 Bacteria 12288
3 JGI24698J34947_10000162 3300002449 Bacteria 25680
4 JGI24698J34947_10002953 3300002449 Bacteria 9219
5 JGI24695J34938_10000011 3300002450 Bacteria 126968
6 JGI24695J34938_10000535 3300002450 Bacteria 36751
7 JGI24695J34938_10006601 3300002450 Bacteria 6926
8 JGI24695J34938_10035490 3300002450 Bacteria 2279
9 JGI24699J35502_11116388 3300002509 Bacteria 2967
10 Ga0072940_1028366 3300005200 Viruses 5865
11 Ga0072941_1010125 3300005201 Bacteria 32533
12 Ga0466715_040467 3300042616 Bacteria 12614
13 Ga0466718_086456 3300042617 Bacteria 7228
14 Ga0466723_099381 3300042618 Bacteria 45625
15 Ga0264413_108725 3300024493 Bacteria 30642
16 Ga0466690_004438 3300042590 Bacteria 17236
17 Ga0466694_080398 3300042594 Bacteria 11142
18 Ga0466694_163429 3300042594 Bacteria 6433
19 Ga0466694_404079 3300042594 Bacteria 8665
20 Ga0466719_236465 3300042606 Bacteria 15116
21 Ga0466720_002057 3300042607 Bacteria 13675
22 Ga0466720_173011 3300042607 Bacteria 13862
23 Ga0466722_136621 3300042609 Bacteria 25553
24 Ga0466731_279015 3300042622 Bacteria 1522
25 Ga0466703_071994 3300042636 Bacteria 30597
26 Ga0466704_043323 3300042643 Bacteria 77338
27 Ga0466708_140355 3300042652 Bacteria 4418
28 Ga0466705_082072 3300042612 Bacteria 49126
29 Ga0466732_033636 3300042656 Bacteria 29236
30 Ga0123356_10007122 3300010049 Bacteria 11202
31 Ga0123356_10008583 3300010049 Bacteria 10139
32 Ga0123356_10020383 3300010049 Bacteria 6274
33 AustNasuHG_c1004588 3300000089 Bacteria 4953
34 JGI24695J34938_10028204 3300002450 Unclassified 2641
35 Ga0072941_1017278 3300005201 Unclassified 2989
36 Ga0072941_1018818 3300005201 Bacteria 10807
37 Ga0072941_1023945 3300005201 Bacteria 25783
38 Ga0072941_1154704 3300005201 Bacteria 8741
39 Ga0466712_158733 3300042614 Bacteria 27639
40 Ga0466711_125284 3300042615 Bacteria 30828
41 Ga0466715_235141 3300042616 Bacteria 9208
42 Ga0466718_124320 3300042617 Bacteria 10158
43 Ga0466723_166915 3300042618 Bacteria 1795
44 Ga0466723_176242 3300042618 Bacteria 78804
45 Ga0466723_365010 3300042618 Bacteria 5342
46 Ga0264413_107063 3300024493 Bacteria 5028
47 Ga0415639_040982 3300038395 Unclassified 2992
48 Ga0415639_136143 3300038395 Bacteria 4064
49 Ga0466692_003461 3300042591 Bacteria 12742
50 Ga0466692_007610 3300042591 Bacteria 31108
51 Ga0466694_129009 3300042594 Bacteria 21104
52 Ga0466696_121016 3300042596 Bacteria 24238
53 Ga0466696_307185 3300042596 Bacteria 6448
54 Ga0466720_023436 3300042607 Bacteria 8788
55 Ga0466721_122058 3300042608 Bacteria 33129
56 Ga0466722_029329 3300042609 Bacteria 14764
57 Ga0466702_105692 3300042635 Bacteria 81204
58 Ga0466708_417706 3300042652 Bacteria 14257
59 Ga0466727_134002 3300042655 Bacteria 7525
60 Ga0123356_10019415 3300010049 Bacteria 6442
61 Ga0123353_10275201 3300010167 Bacteria 2590
62 JGI24698J34947_10002091 3300002449 Bacteria 10673
63 JGI24698J34947_10002825 3300002449 Bacteria 9409
64 JGI24698J34947_10029520 3300002449 Bacteria 2896
65 JGI24695J34938_10000413 3300002450 Bacteria 41558
66 Ga0072941_1002884 3300005201 Bacteria 41345
67 Ga0072941_1026818 3300005201 Bacteria 4396
68 Ga0466712_270394 3300042614 Unclassified 20542
69 Ga0466715_068292 3300042616 Bacteria 12987
70 Ga0466718_095589 3300042617 Bacteria 20834
71 Ga0466718_130347 3300042617 Bacteria 5118
72 Ga0264413_105910 3300024493 Unclassified 24299
73 Ga0466691_107071 3300042593 Bacteria 7485
74 Ga0466720_114725 3300042607 Bacteria 41718
75 Ga0466703_225208 3300042636 Bacteria 6406
76 Ga0466709_204332 3300042648 Bacteria 5787
77 Ga0123356_10006434 3300010049 Bacteria 11839
78 Ga0123353_10003498 3300010167 Bacteria 19854
79 AustNasuHG_c1006147 3300000089 Unclassified 4292
80 JGI24698J34947_10000390 3300002449 Bacteria 19820
81 JGI24695J34938_10000218 3300002450 Bacteria 55166
82 JGI24695J34938_10000607 3300002450 Bacteria 34430
83 JGI24695J34938_10000928 3300002450 Bacteria 26828
84 JGI24702J35022_10003803 3300002462 Bacteria 9063
85 Ga0072941_1001122 3300005201 Bacteria 5422
86 Ga0466718_038297 3300042617 Bacteria 13170
87 Ga0466728_014354 3300042620 Bacteria 7420
88 Ga0264413_107961 3300024493 Unclassified 11232
89 Ga0466692_134979 3300042591 Bacteria 11408
90 Ga0466691_131098 3300042593 Bacteria 16781
91 Ga0466694_009336 3300042594 Bacteria 2425
92 Ga0466708_021268 3300042652 Bacteria 6137
93 Ga0123356_10003240 3300010049 Unclassified 17098
94 Ga0123356_10037227 3300010049 Bacteria 4540
95 Ga0123356_10041798 3300010049 Bacteria 4272
96 Ga0123353_10094390 3300010167 Bacteria 4820
97 JGI24695J34938_10000361 3300002450 Bacteria 44995
98 JGI24695J34938_10000457 3300002450 Bacteria 39704
99 JGI24695J34938_10001083 3300002450 Bacteria 24618
100 Ga0072941_1012382 3300005201 Bacteria 8280
101 Ga0072941_1199738 3300005201 Bacteria 9251
102 Ga0466705_396157 3300042612 Unclassified 6400
103 Ga0466712_102588 3300042614 Bacteria 46662
104 Ga0466712_180050 3300042614 Bacteria 34991
105 Ga0466715_356844 3300042616 Bacteria 16320
106 Ga0466715_373441 3300042616 Bacteria 24508
107 Ga0466715_484508 3300042616 Bacteria 1749
108 Ga0466718_089956 3300042617 Bacteria 6748
109 Ga0466726_157757 3300042619 Bacteria 2398
110 Ga0466726_211606 3300042619 Bacteria 2515
111 Ga0264413_104242 3300024493 Bacteria 22850
112 Ga0264413_119172 3300024493 Bacteria 7702
113 Ga0466690_039374 3300042590 Bacteria 9243
114 Ga0466692_003543 3300042591 Bacteria 4344
115 Ga0466691_023293 3300042593 Bacteria 8253
116 Ga0466696_335197 3300042596 Bacteria 35443
117 Ga0466699_120431 3300042597 Bacteria 3146
118 Ga0466699_331733 3300042597 Bacteria 23355
119 Ga0466713_080146 3300042602 Bacteria 4498
120 Ga0466709_269506 3300042648 Unclassified 2611
121 Ga0466705_047043 3300042612 Bacteria 38569
122 Ga0123356_10000120 3300010049 Bacteria 85763
123 Ga0123356_10000831 3300010049 Bacteria 34393
124 Ga0123356_10076063 3300010049 Unclassified 3163
125 Ga0123356_10094003 3300010049 Bacteria 2862
126 AustNasuHG_c1004978 3300000089 Bacteria 4754
127 JGI24698J34947_10019833 3300002449 Unclassified 3624
128 JGI24698J34947_10042260 3300002449 Bacteria 2343
129 JGI24698J34947_10062705 3300002449 Bacteria 1824
130 JGI24695J34938_10000217 3300002450 Bacteria 55213
131 JGI24695J34938_10044585 3300002450 Bacteria 1972
132 JGI24695J34938_10069185 3300002450 Unclassified 1481
133 Ga0466711_202647 3300042615 Bacteria 36849
134 Ga0466718_018946 3300042617 Bacteria 7798
135 Ga0466718_091218 3300042617 Bacteria 5469
136 Ga0466694_074769 3300042594 Bacteria 2408
137 Ga0466699_237531 3300042597 Bacteria 77856
138 Ga0466707_121410 3300042601 Bacteria 1451
139 Ga0466720_048309 3300042607 Bacteria 7308
140 Ga0466722_200076 3300042609 Bacteria 3396
141 Ga0466731_322096 3300042622 Bacteria 2495
142 Ga0466704_029582 3300042643 Bacteria 40583
143 Ga0466704_469744 3300042643 Bacteria 50861
144 Ga0123356_10000045 3300010049 Bacteria 131000
145 Ga0123356_10002528 3300010049 Bacteria 19556
146 JGI24698J34947_10000072 3300002449 Bacteria 32302
147 JGI24698J34947_10078609 3300002449 Unclassified 1555
148 JGI24695J34938_10000061 3300002450 Bacteria 88663
149 Ga0072941_1019365 3300005201 Bacteria 4589
150 Ga0072941_1072969 3300005201 Bacteria 5790
151 Ga0072941_1122623 3300005201 Bacteria 4541
152 Ga0466712_087397 3300042614 Archaea 4387
153 Ga0466712_087530 3300042614 Bacteria 27503
154 Ga0466715_568790 3300042616 Bacteria 27622
155 Ga0466723_155445 3300042618 Bacteria 27422
156 Ga0264413_103670 3300024493 Bacteria 32135
157 Ga0264413_108661 3300024493 Bacteria 11839
158 Ga0264413_116453 3300024493 Bacteria 3783
159 Ga0466692_013135 3300042591 Bacteria 16769
160 Ga0466692_159452 3300042591 Bacteria 24482
161 Ga0466693_204211 3300042592 Unclassified 11484
162 Ga0466699_404671 3300042597 Bacteria 14187
163 Ga0466720_035308 3300042607 Unclassified 2133
164 Ga0123356_10000830 3300010049 Bacteria 34393
165 JGI24698J34947_10006402 3300002449 Bacteria 6463
166 JGI24695J34938_10000033 3300002450 Bacteria 103928
167 JGI24695J34938_10001152 3300002450 Bacteria 23547
168 Ga0072941_1001838 3300005201 Bacteria 22298
169 Ga0466712_015336 3300042614 Bacteria 28683
170 Ga0466712_032712 3300042614 Bacteria 2035
171 Ga0466715_245235 3300042616 Bacteria 28158
172 Ga0415639_009659 3300038395 Bacteria 10975
173 Ga0466692_161756 3300042591 Unclassified 6220
174 Ga0466692_169663 3300042591 Bacteria 4382
175 Ga0466693_390636 3300042592 Bacteria 20399
176 Ga0466694_080332 3300042594 Bacteria 33396
177 Ga0466694_152003 3300042594 Bacteria 16801
178 Ga0466695_295531 3300042595 Bacteria 145433
179 Ga0466696_144808 3300042596 Bacteria 7848
180 Ga0466722_041602 3300042609 Bacteria 19857
181 Ga0466722_144774 3300042609 Bacteria 23493
182 Ga0466704_551359 3300042643 Bacteria 3094

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13437 HlyD_3 HlyD family secretion protein 316 419 0.96
PF13533 Biotin_lipoyl_2 Biotin-lipoyl like 115 161 0.96
PF16576 HlyD_D23 Barrel-sandwich domain of CusB or HlyD membrane-fusion 302 422 0.89

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.