Protein Family IF06859
Metagenome
Isolate
187
Members
48
Samples
180
Scaffolds
427.79
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_178428|Ga0466722_178428_508_1905
- Length
- 465 aa
- Sequence
- MQKKFALFRLGIKSLYRYRRRYGFLLAALVFGFAVVTFITSAKDGMSDNVYYSAQSHYAGDIVAVGYDTGSLQRYHLGQAEIAAILQAADDSGINSRYTVKRTLFGEKGVVYFNGTAVQLKYVIGSDWEGETPLFNKMTFNGFADIPAGDDGIILSSPVAGKLGARLGDSLILETETVWGQKNTGVFIVRGIAQDSSIFGYYKVYVSRKALNHLVGFGEEDCSSIGFFLDDSGAAEQKRERFQEVLAAYIQTGPLVYDRDELEQATNQPFEGIRVFLYTLPVYLSEIADLLNAMYIITYFLYGMMLLIILVSAVVTYRLILHERIKEMGIMRAIGFYGGDLRLVLWAEVLALGCIALLAGFALAWILSQALAFVPFSWIPSFEIFMRDGKLTALYLPKTVMINIVSVFLVLFAAVLVPAFRTSQKSLPSLLSGEPVRRAIQFDVLWYWGCSSSGRQDFSPAILIC
Sample Types
Isolate
3.7%
Metagenome
96.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
47.8%
Kalotermitidae
28.3%
Unclassified
15.2%
Rhinotermitidae
6.5%
Termopsidae
2.2%
Taxonomy
Archaea
0
Bacteria
180
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 2 | 2781125661 | Treponema sp. Emb289P3bin69 | Isolate | Unclassified |
| 3 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 4 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125660 | Treponema sp. Emb289P3bin52 | Isolate | Unclassified |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 16 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 17 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 18 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 19 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 20 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 21 | 2781125690 | Treponema sp. Th196P3bin63 | Isolate | Unclassified |
| 22 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 23 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 24 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 25 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 26 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 27 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 32 | 2781125643 | Treponema sp. Co191P3bin45 | Isolate | Unclassified |
| 33 | 2781125664 | Treponema sp. Emb289P3bin139 | Isolate | Unclassified |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 36 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 37 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 38 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 39 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 40 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 41 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 42 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 43 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 44 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 45 | 3300002508 | Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 | Metagenome | Termitidae |
| 46 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 47 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 48 | 2819994798 | Unclassified Spirochaetes Th196P1bin3 | Isolate | Unclassified |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_216647 | 3300042656 | Bacteria | 8635 |
| 2 | Ga0466718_002524 | 3300042617 | Bacteria | 42896 |
| 3 | Ga0466718_041811 | 3300042617 | Bacteria | 20555 |
| 4 | Ga0264413_104325 | 3300024493 | Bacteria | 24047 |
| 5 | Ga0264413_107530 | 3300024493 | Bacteria | 24862 |
| 6 | Ga0264413_115040 | 3300024493 | Bacteria | 6159 |
| 7 | Ga0466694_005020 | 3300042594 | Bacteria | 10868 |
| 8 | Ga0466694_280804 | 3300042594 | Bacteria | 1560 |
| 9 | Ga0466695_221990 | 3300042595 | Bacteria | 77793 |
| 10 | Ga0466731_078236 | 3300042622 | Bacteria | 2186 |
| 11 | Ga0466703_046739 | 3300042636 | Bacteria | 28227 |
| 12 | AustNasuHG_c1015698 | 3300000089 | Bacteria | 2550 |
| 13 | AustNasuHG_c1022131 | 3300000089 | Bacteria | 2047 |
| 14 | JGI24698J34947_10000132 | 3300002449 | Bacteria | 27417 |
| 15 | JGI24695J34938_10001794 | 3300002450 | Bacteria | 17657 |
| 16 | Ga0072941_1003979 | 3300005201 | Bacteria | 18560 |
| 17 | Ga0072941_1013127 | 3300005201 | Bacteria | 8166 |
| 18 | Ga0072941_1028220 | 3300005201 | Bacteria | 6215 |
| 19 | Ga0072941_1477782 | 3300005201 | Bacteria | 2640 |
| 20 | Ga0466705_324122 | 3300042612 | Bacteria | 22195 |
| 21 | Ga0466712_069703 | 3300042614 | Bacteria | 18452 |
| 22 | Ga0466712_090242 | 3300042614 | Bacteria | 11818 |
| 23 | Ga0466712_096948 | 3300042614 | Bacteria | 13734 |
| 24 | Ga0466712_220533 | 3300042614 | Bacteria | 2647 |
| 25 | Ga0466712_223592 | 3300042614 | Bacteria | 5084 |
| 26 | Ga0466711_114789 | 3300042615 | Bacteria | 1488 |
| 27 | Ga0466718_083674 | 3300042617 | Bacteria | 23117 |
| 28 | Ga0123353_10107426 | 3300010167 | Bacteria | 4497 |
| 29 | Ga0264413_100365 | 3300024493 | Bacteria | 60695 |
| 30 | Ga0264413_112960 | 3300024493 | Bacteria | 13089 |
| 31 | Ga0466690_086451 | 3300042590 | Bacteria | 9224 |
| 32 | Ga0466694_017836 | 3300042594 | Bacteria | 66785 |
| 33 | Ga0466699_097660 | 3300042597 | Bacteria | 3098 |
| 34 | JGI24698J34947_10009196 | 3300002449 | Bacteria | 5422 |
| 35 | JGI24698J34947_10017592 | 3300002449 | Unclassified | 3872 |
| 36 | JGI24695J34938_10001979 | 3300002450 | Bacteria | 16365 |
| 37 | JGI24702J35022_10002129 | 3300002462 | Bacteria | 12230 |
| 38 | Ga0072940_1017890 | 3300005200 | Bacteria | 10977 |
| 39 | Ga0466716_362076 | 3300042605 | Bacteria | 22472 |
| 40 | Ga0466720_044007 | 3300042607 | Bacteria | 9420 |
| 41 | Ga0466720_178452 | 3300042607 | Bacteria | 61615 |
| 42 | Ga0466732_438831 | 3300042656 | Bacteria | 3856 |
| 43 | Ga0466712_054359 | 3300042614 | Bacteria | 8013 |
| 44 | Ga0466712_145529 | 3300042614 | Bacteria | 4617 |
| 45 | Ga0466712_203680 | 3300042614 | Bacteria | 4772 |
| 46 | Ga0466711_377011 | 3300042615 | Bacteria | 37393 |
| 47 | Ga0466715_016153 | 3300042616 | Bacteria | 4931 |
| 48 | Ga0466718_016236 | 3300042617 | Bacteria | 4207 |
| 49 | Ga0123357_10063765 | 3300009784 | Bacteria | 4927 |
| 50 | Ga0123356_10000059 | 3300010049 | Bacteria | 117133 |
| 51 | Ga0264413_105820 | 3300024493 | Bacteria | 10451 |
| 52 | Ga0264413_127494 | 3300024493 | Bacteria | 2767 |
| 53 | Ga0466692_139793 | 3300042591 | Bacteria | 3583 |
| 54 | Ga0466691_063439 | 3300042593 | Bacteria | 8495 |
| 55 | Ga0466691_185422 | 3300042593 | Bacteria | 12554 |
| 56 | Ga0466699_424708 | 3300042597 | Bacteria | 1679 |
| 57 | AustNasuHG_c1002524 | 3300000089 | Bacteria | 6628 |
| 58 | AustNasuHG_c1005385 | 3300000089 | Bacteria | 4572 |
| 59 | JGI24698J34947_10001287 | 3300002449 | Unclassified | 13139 |
| 60 | JGI24698J34947_10011413 | 3300002449 | Unclassified | 4878 |
| 61 | JGI24698J34947_10014365 | 3300002449 | Bacteria | 4310 |
| 62 | JGI24695J34938_10000048 | 3300002450 | Bacteria | 91577 |
| 63 | JGI24695J34938_10000188 | 3300002450 | Bacteria | 57980 |
| 64 | JGI24702J35022_10013457 | 3300002462 | Bacteria | 4533 |
| 65 | Ga0072941_1013155 | 3300005201 | Bacteria | 6527 |
| 66 | Ga0072941_1013156 | 3300005201 | Bacteria | 9897 |
| 67 | Ga0466700_349550 | 3300042600 | Bacteria | 2551 |
| 68 | Ga0466720_001658 | 3300042607 | Bacteria | 58257 |
| 69 | Ga0466720_064404 | 3300042607 | Bacteria | 4921 |
| 70 | Ga0466720_108024 | 3300042607 | Bacteria | 60869 |
| 71 | Ga0466712_067544 | 3300042614 | Bacteria | 41898 |
| 72 | Ga0466712_081486 | 3300042614 | Bacteria | 16849 |
| 73 | Ga0466715_152240 | 3300042616 | Bacteria | 5280 |
| 74 | Ga0466718_043842 | 3300042617 | Bacteria | 9656 |
| 75 | Ga0466718_155889 | 3300042617 | Bacteria | 4071 |
| 76 | Ga0123356_10007426 | 3300010049 | Bacteria | 10935 |
| 77 | Ga0123356_10088215 | 3300010049 | Bacteria | 2949 |
| 78 | Ga0264413_104322 | 3300024493 | Bacteria | 7773 |
| 79 | Ga0415639_050496 | 3300038395 | Unclassified | 5892 |
| 80 | Ga0466709_258684 | 3300042648 | Bacteria | 2801 |
| 81 | Ga0466727_277538 | 3300042655 | Bacteria | 10191 |
| 82 | AustNasuHG_c1001722 | 3300000089 | Bacteria | 7904 |
| 83 | AustNasuHG_c1002941 | 3300000089 | Bacteria | 6134 |
| 84 | JGI24695J34938_10000232 | 3300002450 | Bacteria | 52996 |
| 85 | JGI24695J34938_10000444 | 3300002450 | Bacteria | 40024 |
| 86 | JGI24695J34938_10035419 | 3300002450 | Bacteria | 2283 |
| 87 | JGI24695J34938_10051472 | 3300002450 | Bacteria | 1802 |
| 88 | JGI24700J35501_10930491 | 3300002508 | Bacteria | 14675 |
| 89 | Ga0072941_1023156 | 3300005201 | Bacteria | 7267 |
| 90 | Ga0072941_1038484 | 3300005201 | Bacteria | 5484 |
| 91 | Ga0072941_1257642 | 3300005201 | Bacteria | 3869 |
| 92 | Ga0466720_165650 | 3300042607 | Bacteria | 4788 |
| 93 | Ga0466722_197448 | 3300042609 | Bacteria | 1896 |
| 94 | Ga0466732_071295 | 3300042656 | Bacteria | 4503 |
| 95 | Ga0466732_139720 | 3300042656 | Bacteria | 6370 |
| 96 | Ga0466712_029124 | 3300042614 | Bacteria | 12816 |
| 97 | Ga0466712_049072 | 3300042614 | Bacteria | 2851 |
| 98 | Ga0466712_098031 | 3300042614 | Bacteria | 43056 |
| 99 | Ga0466712_252403 | 3300042614 | Bacteria | 4337 |
| 100 | Ga0466715_183835 | 3300042616 | Bacteria | 10489 |
| 101 | Ga0466718_027380 | 3300042617 | Bacteria | 5108 |
| 102 | Ga0466723_118108 | 3300042618 | Bacteria | 8565 |
| 103 | Ga0123357_10192483 | 3300009784 | Bacteria | 2346 |
| 104 | Ga0264413_105979 | 3300024493 | Bacteria | 7443 |
| 105 | AustNasuHG_c1022352 | 3300000089 | Bacteria | 2033 |
| 106 | AustNasuHG_c1026231 | 3300000089 | Bacteria | 1818 |
| 107 | JGI24698J34947_10041246 | 3300002449 | Bacteria | 2378 |
| 108 | JGI24695J34938_10001088 | 3300002450 | Bacteria | 24555 |
| 109 | JGI24695J34938_10001748 | 3300002450 | Bacteria | 17965 |
| 110 | JGI24695J34938_10003068 | 3300002450 | Bacteria | 11958 |
| 111 | JGI24695J34938_10013113 | 3300002450 | Bacteria | 4364 |
| 112 | Ga0072940_1172303 | 3300005200 | Bacteria | 1708 |
| 113 | Ga0466720_071514 | 3300042607 | Bacteria | 7242 |
| 114 | Ga0466722_178428 | 3300042609 | Bacteria | 3882 |
| 115 | Ga0466712_306462 | 3300042614 | Bacteria | 8550 |
| 116 | Ga0466711_408355 | 3300042615 | Bacteria | 5454 |
| 117 | Ga0466718_157471 | 3300042617 | Bacteria | 29584 |
| 118 | Ga0466723_056745 | 3300042618 | Bacteria | 10718 |
| 119 | Ga0123356_10013089 | 3300010049 | Bacteria | 8024 |
| 120 | Ga0264413_104284 | 3300024493 | Bacteria | 9049 |
| 121 | Ga0264413_131988 | 3300024493 | Bacteria | 4843 |
| 122 | Ga0456237_0000577 | 3300041968 | Bacteria | 5575 |
| 123 | Ga0466694_239701 | 3300042594 | Bacteria | 3775 |
| 124 | Ga0466696_426094 | 3300042596 | Bacteria | 4630 |
| 125 | Ga0466731_263901 | 3300042622 | Bacteria | 3467 |
| 126 | AustNasuHG_c1000958 | 3300000089 | Bacteria | 10425 |
| 127 | AustNasuHG_c1008158 | 3300000089 | Bacteria | 3715 |
| 128 | JGI24695J34938_10072288 | 3300002450 | Bacteria | 1439 |
| 129 | Ga0072940_1004615 | 3300005200 | Bacteria | 8291 |
| 130 | Ga0072940_1011159 | 3300005200 | Bacteria | 5568 |
| 131 | Ga0072941_1013154 | 3300005201 | Bacteria | 7750 |
| 132 | Ga0466720_174880 | 3300042607 | Bacteria | 19806 |
| 133 | Ga0466722_073142 | 3300042609 | Bacteria | 1232 |
| 134 | Ga0466732_009972 | 3300042656 | Bacteria | 4028 |
| 135 | Ga0466718_030330 | 3300042617 | Bacteria | 7734 |
| 136 | Ga0466718_039959 | 3300042617 | Bacteria | 4747 |
| 137 | Ga0264413_100367 | 3300024493 | Bacteria | 29796 |
| 138 | Ga0264413_131916 | 3300024493 | Unclassified | 5201 |
| 139 | Ga0466692_003325 | 3300042591 | Bacteria | 7132 |
| 140 | Ga0466694_023775 | 3300042594 | Bacteria | 39540 |
| 141 | Ga0466699_013067 | 3300042597 | Bacteria | 13318 |
| 142 | Ga0466699_169385 | 3300042597 | Bacteria | 38335 |
| 143 | AustNasuHG_c1004594 | 3300000089 | Bacteria | 4952 |
| 144 | JGI24698J34947_10000858 | 3300002449 | Unclassified | 15309 |
| 145 | JGI24698J34947_10004039 | 3300002449 | Bacteria | 7975 |
| 146 | JGI24698J34947_10004366 | 3300002449 | Bacteria | 7693 |
| 147 | JGI24698J34947_10019405 | 3300002449 | Bacteria | 3667 |
| 148 | JGI24695J34938_10003603 | 3300002450 | Bacteria | 10639 |
| 149 | Ga0072941_1023158 | 3300005201 | Bacteria | 12993 |
| 150 | Ga0072941_1100582 | 3300005201 | Bacteria | 6154 |
| 151 | Ga0072941_1171642 | 3300005201 | Unclassified | 5179 |
| 152 | Ga0466700_164898 | 3300042600 | Bacteria | 3918 |
| 153 | Ga0466719_224760 | 3300042606 | Bacteria | 8391 |
| 154 | Ga0466721_002814 | 3300042608 | Bacteria | 1834 |
| 155 | Ga0466732_028038 | 3300042656 | Bacteria | 10403 |
| 156 | Ga0466712_139760 | 3300042614 | Bacteria | 32143 |
| 157 | Ga0466718_013198 | 3300042617 | Bacteria | 1398 |
| 158 | Ga0466718_075255 | 3300042617 | Bacteria | 21483 |
| 159 | Ga0466728_065934 | 3300042620 | Bacteria | 4410 |
| 160 | Ga0123357_10101235 | 3300009784 | Bacteria | 3713 |
| 161 | Ga0123356_10042379 | 3300010049 | Bacteria | 4240 |
| 162 | Ga0123356_10070687 | 3300010049 | Bacteria | 3274 |
| 163 | Ga0415639_019723 | 3300038395 | Bacteria | 4904 |
| 164 | Ga0456237_0002328 | 3300041968 | Bacteria | 3076 |
| 165 | Ga0466693_259409 | 3300042592 | Bacteria | 1339 |
| 166 | Ga0466694_034023 | 3300042594 | Bacteria | 6000 |
| 167 | Ga0466694_259193 | 3300042594 | Bacteria | 1851 |
| 168 | Ga0466699_171508 | 3300042597 | Bacteria | 1539 |
| 169 | Ga0466702_458504 | 3300042635 | Bacteria | 11776 |
| 170 | Ga0466704_112416 | 3300042643 | Bacteria | 17765 |
| 171 | Ga0466704_520064 | 3300042643 | Bacteria | 11148 |
| 172 | AustNasuHG_c1001681 | 3300000089 | Bacteria | 7984 |
| 173 | JGI24698J34947_10000214 | 3300002449 | Bacteria | 23866 |
| 174 | JGI24698J34947_10000934 | 3300002449 | Bacteria | 14856 |
| 175 | JGI24698J34947_10031668 | 3300002449 | Bacteria | 2782 |
| 176 | Ga0072940_1164455 | 3300005200 | Bacteria | 3767 |
| 177 | Ga0072941_1021659 | 3300005201 | Bacteria | 6805 |
| 178 | Ga0072941_1590891 | 3300005201 | Bacteria | 1659 |
| 179 | Ga0466720_020718 | 3300042607 | Bacteria | 10578 |
| 180 | Ga0466722_017176 | 3300042609 | Bacteria | 1525 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02687 | GO:0016020 | membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.