Protein Family IF06818

Metagenome Isolate
123 Members
44 Samples
117 Scaffolds
201.65 Avg Length

🧬 Representative Sequence

ID
3300042609|Ga0466722_126833|Ga0466722_126833_520_1221
Length
233 aa
Sequence
MGSCLPNIIGPFFLSDIKEHNVDKKLILPSGGIMTYGYIRVSTDRQTVDNQRFEIERFCSKNGCAVEQWIEETISGTKSPEKRLLGSLLSAVKKGDLIVCSELSRLGRSLFMIMSILNQLMVNEVRVWTIKDNYRLGDNIQSKVLAFAFRLSAEIERDLISQRTKEALARKRSEGVVLGRPIGRKSSHVKLSGHEKEIQALLGKHTSKSAIGRMFGVNRMTVDSFIKERMKKQ

📊 Sample Types

Isolate 4.9%
Metagenome 95.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 44.2%
Kalotermitidae 25.6%
Unclassified 16.3%
Rhinotermitidae 9.3%
Termopsidae 4.7%

🌳 Taxonomy

Archaea 0
Bacteria 105
Eukaryota 0
Viruses 0
Unclassified 18

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
3 3300005201 Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome Metagenome
4 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
5 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
6 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
7 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
8 3300042603 Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 Metagenome Termitidae
9 3300042607 Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 Metagenome Termitidae
10 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
11 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
12 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
13 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
14 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
15 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
16 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
17 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
18 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
19 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
20 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
21 2781125649 Treponema sp. Co191P3bin15 Isolate Unclassified
22 3300042621 Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 Metagenome Rhinotermitidae
23 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
24 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
25 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
26 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
27 3300042659 Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 Metagenome Termitidae
28 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
29 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
30 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
31 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
32 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
33 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
34 2781125648 Treponema sp. Co191P3bin70 Isolate Unclassified
35 2781125650 Treponema sp. Co191P3bin64 Isolate Unclassified
36 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
37 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
38 3300038395 Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut Metagenome Termitidae
39 3300041968 Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 Metagenome Rhinotermitidae
40 3300042592 Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 Metagenome Termitidae
41 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
42 2781125637 Treponema sp. Co191P1bin9 Isolate Unclassified
43 2781125635 Treponema sp. Co191P1bin60 Isolate Unclassified
44 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466712_082116 3300042614 Bacteria 8305
2 AustNasuHG_c1010218 3300000089 Bacteria 3276
3 JGI24695J34938_10000168 3300002450 Bacteria 61343
4 Ga0072941_1032353 3300005201 Bacteria 15076
5 Ga0072941_1048217 3300005201 Bacteria 5495
6 Ga0466703_263904 3300042636 Bacteria 5111
7 Ga0466703_410182 3300042636 Bacteria 3025
8 Ga0415639_114886 3300038395 Bacteria 2848
9 Ga0466707_289025 3300042601 Bacteria 2536
10 Ga0466714_092456 3300042603 Bacteria 5921
11 Ga0466719_026030 3300042606 Bacteria 10120
12 Ga0466705_298248 3300042612 Bacteria 17413
13 Ga0466733_172650 3300042659 Bacteria 1651
14 Ga0466712_045890 3300042614 Bacteria 4299
15 Ga0466729_162010 3300042621 Bacteria 4263
16 Ga0123356_10189868 3300010049 Bacteria 2084
17 JGI24695J34938_10141046 3300002450 Bacteria 985
18 Ga0466731_214532 3300042622 Bacteria 6432
19 Ga0466703_012797 3300042636 Bacteria 1824
20 Ga0466704_552521 3300042643 Bacteria 1498
21 Ga0466699_315982 3300042597 Unclassified 3934
22 Ga0466719_491608 3300042606 Bacteria 2009
23 Ga0466705_253389 3300042612 Bacteria 2431
24 Ga0466705_281005 3300042612 Unclassified 1157
25 Ga0466712_010821 3300042614 Bacteria 7638
26 Ga0466726_068976 3300042619 Bacteria 8035
27 Ga0123356_10018125 3300010049 Bacteria 6687
28 Ga0123353_10996835 3300010167 Bacteria 1126
29 JGI24698J34947_10004771 3300002449 Bacteria 7408
30 JGI24698J34947_10012571 3300002449 Bacteria 4638
31 JGI24698J34947_10013720 3300002449 Bacteria 4415
32 JGI24698J34947_10014150 3300002449 Unclassified 4345
33 JGI24695J34938_10007080 3300002450 Bacteria 6633
34 JGI24695J34938_10011975 3300002450 Bacteria 4628
35 JGI24695J34938_10043592 3300002450 Bacteria 2000
36 JGI24695J34938_10094715 3300002450 Bacteria 1223
37 Ga0072941_1078750 3300005201 Bacteria 1277
38 Ga0466704_371748 3300042643 Bacteria 3113
39 Ga0456237_0003359 3300041968 Unclassified 2595
40 Ga0466690_008455 3300042590 Bacteria 1897
41 Ga0466696_497435 3300042596 Unclassified 1223
42 Ga0466718_033043 3300042617 Bacteria 45100
43 Ga0466726_298979 3300042619 Bacteria 4041
44 Ga0123356_10181919 3300010049 Bacteria 2124
45 JGI24698J34947_10004615 3300002449 Bacteria 7510
46 JGI24698J34947_10014176 3300002449 Bacteria 4340
47 JGI24698J34947_10015493 3300002449 Bacteria 4147
48 JGI24698J34947_10064202 3300002449 Bacteria 1796
49 JGI24698J34947_10094587 3300002449 Unclassified 1361
50 JGI24695J34938_10002252 3300002450 Bacteria 14924
51 JGI24695J34938_10034709 3300002450 Bacteria 2312
52 JGI24695J34938_10036852 3300002450 Bacteria 2226
53 Ga0072941_1011790 3300005201 Bacteria 9974
54 Ga0072941_1030165 3300005201 Bacteria 5080
55 Ga0466731_375391 3300042622 Bacteria 1178
56 Ga0466703_101729 3300042636 Bacteria 1658
57 Ga0466704_274857 3300042643 Bacteria 37737
58 Ga0466709_084556 3300042648 Unclassified 3648
59 Ga0466709_131177 3300042648 Bacteria 3377
60 Ga0466708_162516 3300042652 Unclassified 9395
61 Ga0466719_246623 3300042606 Bacteria 3606
62 Ga0466705_030822 3300042612 Bacteria 4470
63 Ga0466711_085134 3300042615 Unclassified 2470
64 Ga0466711_117447 3300042615 Bacteria 1995
65 Ga0466711_413128 3300042615 Bacteria 1628
66 Ga0123356_10002470 3300010049 Bacteria 19739
67 Ga0123356_10007056 3300010049 Bacteria 11263
68 JGI24695J34938_10001317 3300002450 Bacteria 21601
69 JGI24695J34938_10103285 3300002450 Bacteria 1163
70 JGI24699J35502_10973153 3300002509 Unclassified 1244
71 Ga0466727_217322 3300042655 Bacteria 3388
72 Ga0466690_092441 3300042590 Unclassified 3398
73 Ga0466699_220689 3300042597 Bacteria 48448
74 Ga0466720_224621 3300042607 Bacteria 1463
75 Ga0466712_187364 3300042614 Bacteria 1886
76 Ga0466712_305372 3300042614 Bacteria 7136
77 JGI24698J34947_10005630 3300002449 Bacteria 6869
78 JGI24695J34938_10005930 3300002450 Bacteria 7482
79 JGI24695J34938_10007448 3300002450 Unclassified 6404
80 JGI24695J34938_10021143 3300002450 Bacteria 3188
81 Ga0466702_037446 3300042635 Bacteria 3802
82 Ga0466702_243758 3300042635 Bacteria 1785
83 Ga0466702_449987 3300042635 Bacteria 1949
84 Ga0466692_017977 3300042591 Bacteria 1553
85 Ga0466691_038891 3300042593 Bacteria 11207
86 Ga0466694_229859 3300042594 Bacteria 4306
87 Ga0466696_113961 3300042596 Bacteria 1356
88 Ga0466719_066927 3300042606 Unclassified 2133
89 Ga0466721_401720 3300042608 Bacteria 1578
90 Ga0466722_027908 3300042609 Bacteria 3790
91 Ga0466726_110922 3300042619 Bacteria 3056
92 Ga0466728_046692 3300042620 Bacteria 3554
93 Ga0123356_11540150 3300010049 Bacteria 821
94 JGI24698J34947_10012592 3300002449 Bacteria 4634
95 JGI24695J34938_10000429 3300002450 Bacteria 40528
96 JGI24695J34938_10001921 3300002450 Bacteria 16770
97 JGI24695J34938_10019123 3300002450 Bacteria 3403
98 JGI24699J35502_11006797 3300002509 Bacteria 1379
99 Ga0072941_1037794 3300005201 Bacteria 6704
100 Ga0072941_1079152 3300005201 Bacteria 1185
101 Ga0072941_1084856 3300005201 Unclassified 2644
102 Ga0466703_174554 3300042636 Bacteria 29909
103 Ga0466709_059458 3300042648 Bacteria 4742
104 Ga0466692_063654 3300042591 Bacteria 4724
105 Ga0466722_126833 3300042609 Bacteria 1325
106 Ga0466705_364394 3300042612 Unclassified 1197
107 Ga0466712_015781 3300042614 Bacteria 18695
108 JGI24698J34947_10045417 3300002449 Bacteria 2242
109 JGI24700J35501_10926680 3300002508 Unclassified 6389
110 Ga0466702_108375 3300042635 Bacteria 3709
111 Ga0466702_246707 3300042635 Bacteria 1174
112 Ga0415639_001736 3300038395 Bacteria 4357
113 Ga0415639_007583 3300038395 Bacteria 1721
114 Ga0466690_097458 3300042590 Bacteria 1520
115 Ga0466693_215461 3300042592 Bacteria 8040
116 Ga0466691_216930 3300042593 Unclassified 10475
117 Ga0466722_031915 3300042609 Unclassified 10057

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042601 Ga0466707_289025 Ga0466707_289025_1847_2422 191
2 3300002449 JGI24698J34947_10005630 JGI24698J34947_100056303 194
3 3300002449 JGI24698J34947_10013720 JGI24698J34947_100137204 194
4 3300038395 Ga0415639_001736 Ga0415639_001736_3668_4261 197
5 3300038395 Ga0415639_114886 Ga0415639_114886_2066_2659 197
6 3300042597 Ga0466699_315982 Ga0466699_315982_345_938 197
7 3300002450 JGI24695J34938_10001921 JGI24695J34938_100019216 198
8 3300002450 JGI24695J34938_10011975 JGI24695J34938_100119753 198
9 3300002450 JGI24695J34938_10019123 JGI24695J34938_100191233 198
10 3300002450 JGI24695J34938_10021143 JGI24695J34938_100211431 198
11 3300002450 JGI24695J34938_10036852 JGI24695J34938_100368521 198
12 3300002450 JGI24695J34938_10103285 JGI24695J34938_101032852 198
13 3300002450 JGI24695J34938_10141046 JGI24695J34938_101410461 198
14 3300005201 Ga0072941_1030165 Ga0072941_10301652 198
15 3300005201 Ga0072941_1079152 Ga0072941_10791522 198
16 3300005201 Ga0072941_1084856 Ga0072941_10848562 198
17 3300042609 Ga0466722_031915 Ga0466722_031915_1557_2153 198
18 3300042612 Ga0466705_253389 Ga0466705_253389_1566_2162 198
19 3300042612 Ga0466705_364394 Ga0466705_364394_88_684 198
20 3300042621 Ga0466729_162010 Ga0466729_162010_3362_3958 198
21 3300042659 Ga0466733_172650 Ga0466733_172650_377_973 198
22 3300010049 Ga0123356_10002470 Ga0123356_1000247021 199
23 3300038395 Ga0415639_007583 Ga0415639_007583_668_1267 199
24 3300042590 Ga0466690_092441 Ga0466690_092441_273_872 199
25 3300042591 Ga0466692_017977 Ga0466692_017977_528_1127 199
26 3300042593 Ga0466691_216930 Ga0466691_216930_2865_3464 199
27 3300042594 Ga0466694_229859 Ga0466694_229859_1527_2126 199
28 3300042596 Ga0466696_113961 Ga0466696_113961_29_628 199
29 3300042596 Ga0466696_497435 Ga0466696_497435_313_912 199
30 3300042597 Ga0466699_220689 Ga0466699_220689_194_793 199
31 3300042603 Ga0466714_092456 Ga0466714_092456_29_628 199
32 3300042606 Ga0466719_026030 Ga0466719_026030_5412_6011 199
33 3300042606 Ga0466719_246623 Ga0466719_246623_1564_2163 199
34 3300042606 Ga0466719_491608 Ga0466719_491608_170_769 199
35 3300042609 Ga0466722_027908 Ga0466722_027908_933_1532 199
36 3300042612 Ga0466705_030822 Ga0466705_030822_3691_4290 199
37 3300042612 Ga0466705_281005 Ga0466705_281005_298_897 199
38 3300042612 Ga0466705_298248 Ga0466705_298248_973_1572 199
39 3300042614 Ga0466712_015781 Ga0466712_015781_2993_3592 199
40 3300042614 Ga0466712_187364 Ga0466712_187364_410_1009 199
41 3300042615 Ga0466711_085134 Ga0466711_085134_1316_1915 199
42 3300042615 Ga0466711_413128 Ga0466711_413128_275_874 199
43 3300042619 Ga0466726_298979 Ga0466726_298979_3160_3759 199
44 3300042620 Ga0466728_046692 Ga0466728_046692_297_896 199
45 3300042622 Ga0466731_214532 Ga0466731_214532_3078_3677 199
46 3300042636 Ga0466703_012797 Ga0466703_012797_172_771 199
47 3300042636 Ga0466703_101729 Ga0466703_101729_86_685 199
48 3300042636 Ga0466703_263904 Ga0466703_263904_3796_4395 199
49 3300042643 Ga0466704_274857 Ga0466704_274857_35380_35979 199
50 3300042643 Ga0466704_371748 Ga0466704_371748_1883_2482 199
51 3300042643 Ga0466704_552521 Ga0466704_552521_718_1317 199
52 3300042648 Ga0466709_084556 Ga0466709_084556_1034_1633 199
53 3300042648 Ga0466709_131177 Ga0466709_131177_2112_2711 199
54 3300042652 Ga0466708_162516 Ga0466708_162516_8606_9205 199
55 iso_pr_bacteria 2781125635 2781278804 199
56 3300002449 JGI24698J34947_10014176 JGI24698J34947_100141761 200
57 3300002449 JGI24698J34947_10064202 JGI24698J34947_100642022 200
58 3300002449 JGI24698J34947_10094587 JGI24698J34947_100945872 200
59 3300002450 JGI24695J34938_10000429 JGI24695J34938_1000042912 200
60 3300005201 Ga0072941_1011790 Ga0072941_10117905 200
61 3300010049 Ga0123356_10007056 Ga0123356_100070564 200
62 3300010049 Ga0123356_11540150 Ga0123356_115401501 200
63 3300042590 Ga0466690_097458 Ga0466690_097458_48_650 200
64 3300042614 Ga0466712_045890 Ga0466712_045890_180_782 200
65 iso_pr_bacteria 2781125650 2781308051 200
66 3300002449 JGI24698J34947_10014150 JGI24698J34947_100141502 201
67 3300002450 JGI24695J34938_10000168 JGI24695J34938_100001684 201
68 3300002450 JGI24695J34938_10001317 JGI24695J34938_100013174 201
69 3300002450 JGI24695J34938_10007080 JGI24695J34938_100070808 201
70 3300002450 JGI24695J34938_10043592 JGI24695J34938_100435922 201
71 3300002509 JGI24699J35502_10973153 JGI24699J35502_109731531 201
72 3300010167 Ga0123353_10996835 Ga0123353_109968352 201
73 3300042592 Ga0466693_215461 Ga0466693_215461_7212_7817 201
74 3300042606 Ga0466719_066927 Ga0466719_066927_300_905 201
75 3300042614 Ga0466712_010821 Ga0466712_010821_860_1465 201
76 3300042614 Ga0466712_082116 Ga0466712_082116_3444_4049 201
77 3300042614 Ga0466712_305372 Ga0466712_305372_4656_5261 201
78 3300042617 Ga0466718_033043 Ga0466718_033043_43087_43692 201
79 3300042635 Ga0466702_246707 Ga0466702_246707_375_980 201
80 iso_pr_bacteria 2819994798 2819995486 201
81 3300000089 AustNasuHG_c1010218 AustNasuHG_10102181 202
82 3300002449 JGI24698J34947_10015493 JGI24698J34947_100154932 202
83 3300002449 JGI24698J34947_10045417 JGI24698J34947_100454171 202
84 3300002450 JGI24695J34938_10094715 JGI24695J34938_100947151 202
85 3300002508 JGI24700J35501_10926680 JGI24700J35501_109266801 202
86 3300002509 JGI24699J35502_11006797 JGI24699J35502_110067972 202
87 3300010049 Ga0123356_10018125 Ga0123356_100181255 202
88 3300010049 Ga0123356_10181919 Ga0123356_101819192 202
89 3300042593 Ga0466691_038891 Ga0466691_038891_1986_2594 202
90 3300042619 Ga0466726_068976 Ga0466726_068976_6806_7414 202
91 3300042619 Ga0466726_110922 Ga0466726_110922_81_689 202
92 3300042622 Ga0466731_375391 Ga0466731_375391_398_1006 202
93 3300002449 JGI24698J34947_10004771 JGI24698J34947_100047716 203
94 3300002449 JGI24698J34947_10012571 JGI24698J34947_100125712 203
95 3300005201 Ga0072941_1037794 Ga0072941_10377944 203
96 3300005201 Ga0072941_1048217 Ga0072941_10482172 203
97 3300041968 Ga0456237_0003359 Ga0456237_0003359_151_762 203
98 3300042591 Ga0466692_063654 Ga0466692_063654_3294_3905 203
99 3300042635 Ga0466702_449987 Ga0466702_449987_925_1536 203
100 3300042635 Ga0466702_108375 Ga0466702_108375_2657_3271 204
101 3300002449 JGI24698J34947_10004615 JGI24698J34947_100046156 205
102 3300002449 JGI24698J34947_10012592 JGI24698J34947_100125922 205
103 3300002450 JGI24695J34938_10034709 JGI24695J34938_100347092 205
104 3300042636 Ga0466703_174554 Ga0466703_174554_6830_7447 205
105 iso_pr_bacteria 2781125637 2781282076 205
106 iso_pr_bacteria 2781125649 2781307366 205
107 3300002450 JGI24695J34938_10007448 JGI24695J34938_100074482 206
108 3300010049 Ga0123356_10189868 Ga0123356_101898682 206
109 3300002450 JGI24695J34938_10005930 JGI24695J34938_100059307 207
110 3300042608 Ga0466721_401720 Ga0466721_401720_265_888 207
111 3300042655 Ga0466727_217322 Ga0466727_217322_1163_1789 208
112 iso_pr_bacteria 2781125648 2781305601 208
113 3300002450 JGI24695J34938_10002252 JGI24695J34938_100022524 209
114 3300042636 Ga0466703_410182 Ga0466703_410182_38_667 209
115 3300005201 Ga0072941_1032353 Ga0072941_103235317 210
116 3300005201 Ga0072941_1078750 Ga0072941_10787502 210
117 3300042607 Ga0466720_224621 Ga0466720_224621_561_1199 212
118 3300042648 Ga0466709_059458 Ga0466709_059458_3726_4364 212
119 3300042615 Ga0466711_117447 Ga0466711_117447_756_1397 213
120 3300042635 Ga0466702_243758 Ga0466702_243758_620_1264 214
121 3300042635 Ga0466702_037446 Ga0466702_037446_2829_3476 215
122 3300042590 Ga0466690_008455 Ga0466690_008455_380_1054 224
123 3300042609 Ga0466722_126833 Ga0466722_126833_520_1221 233

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF00239 Resolvase Resolvase, N terminal domain 36 176 0.95

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.47 0.57 Medium

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.