Protein Family IF06726
Metagenome
Metatranscriptome
Isolate
199
Members
68
Samples
173
Scaffolds
359.64
Avg Length
Representative Sequence
- ID
- 3300042609|Ga0466722_012089|Ga0466722_012089_3508_4719
- Length
- 403 aa
- Sequence
- VLVRTAGLWETGSLALIDLFGNCANLAKFPNNFNVWNGGNFMKKTIAAVLAALVLTGLAACGGQKGEQKGETFDLALVTDLGTIDDKSFNQGAWEGLAQYAQEKNISYKYYQPSEQSDDAYLSGIDIAVKGGAKIVVTPGFLFEVPIYIAQDRYPEVHFILVDGVPHDAGYENFKTGPNAVGINYAEDQAGFLAGYAAVKDGNTKLGFVGGMAVPAVVRFGYGFIQGAEYAAAELALAPGSVTVNYHYTGAFAASPEAQTLAASWYNNGVEVIFACGGAVGNSVMAAAEQSGKKVIGVDVDQSSESPTVITSATKGLRPSVYSCISDFYNDAFPGGETLVFSAANEGVGLPMETSKFNTFSKADYDTIYATLASGAIPRMDTLDPEGSPRVVPVTIAKVTEVK
Sample Types
Isolate
12.6%
Metagenome
86.9%
MAG
0.0%
Metatranscriptome
0.5%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
43.9%
Unclassified
34.8%
Kalotermitidae
15.2%
Termopsidae
3.0%
Hodotermitidae
1.5%
Rhinotermitidae
1.5%
Taxonomy
Archaea
0
Bacteria
197
Eukaryota
0
Viruses
0
Unclassified
2
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 2 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 3 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 4 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 5 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 6 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 7 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 8 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 11 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300021190 | Termite gut microbial communities from nest - French Guiana - 1_3 mRNA 1_3 mRNA SA | Metatranscriptome | Termitidae |
| 15 | 2781125642 | Treponema sp. Co191P1bin35 | Isolate | Unclassified |
| 16 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 17 | 2781125659 | Treponema sp. Emb289P3bin114 | Isolate | Unclassified |
| 18 | 2820314258 | Unclassified Firmicutes Nt197P4bin16 | Isolate | Unclassified |
| 19 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 20 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 21 | 2781125638 | Treponema sp. Co191P1bin8 | Isolate | Unclassified |
| 22 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 23 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 24 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 25 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 26 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 27 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 28 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 29 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 30 | 2781125648 | Treponema sp. Co191P3bin70 | Isolate | Unclassified |
| 31 | 2781125650 | Treponema sp. Co191P3bin64 | Isolate | Unclassified |
| 32 | 2781125651 | Treponema sp. Co191P3bin8 | Isolate | Unclassified |
| 33 | 3300042649 | Termite gut microbial communities of Procubitermes c.f. undulans from Ebogo II, Mbalmayo, Cameroon - Pcu381 | Metagenome | Termitidae |
| 34 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 35 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 36 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 37 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 38 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 39 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 40 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 41 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 42 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 43 | 2781125634 | Treponema sp. Co191P1bin45 | Isolate | Unclassified |
| 44 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 45 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 46 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 47 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 48 | 2781125662 | Treponema sp. Emb289P3bin141 | Isolate | Unclassified |
| 49 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 50 | 2820347164 | Unclassified Firmicutes Nt197P3bin58 | Isolate | Unclassified |
| 51 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 52 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 53 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 54 | 2781125697 | Treponema sp. Th196P4bin17 | Isolate | Unclassified |
| 55 | 2820312173 | Unclassified Firmicutes Nt197P4bin8 | Isolate | Unclassified |
| 56 | 2820332331 | Unclassified Firmicutes Nt197P3bin75 | Isolate | Unclassified |
| 57 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 58 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 59 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 60 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 61 | 2820324456 | Unclassified Firmicutes Nt197P3bin80 | Isolate | Unclassified |
| 62 | 2820427814 | Unclassified Firmicutes Lab288P3bin44 | Isolate | Unclassified |
| 63 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 64 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 65 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 66 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 67 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 68 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0415639_119212 | 3300038395 | Bacteria | 1367 |
| 2 | Ga0466696_050727 | 3300042596 | Bacteria | 9606 |
| 3 | Ga0466714_035275 | 3300042603 | Bacteria | 5111 |
| 4 | Ga0466720_043964 | 3300042607 | Bacteria | 8445 |
| 5 | Ga0466722_012089 | 3300042609 | Bacteria | 7253 |
| 6 | Ga0123356_10021919 | 3300010049 | Bacteria | 6032 |
| 7 | AustNasuHG_c1007590 | 3300000089 | Bacteria | 3848 |
| 8 | JGI24698J34947_10003260 | 3300002449 | Bacteria | 8788 |
| 9 | JGI24698J34947_10029891 | 3300002449 | Bacteria | 2876 |
| 10 | JGI24698J34947_10055340 | 3300002449 | Bacteria | 1977 |
| 11 | JGI24695J34938_10001332 | 3300002450 | Bacteria | 21349 |
| 12 | JGI24695J34938_10010396 | 3300002450 | Bacteria | 5094 |
| 13 | JGI24695J34938_10010889 | 3300002450 | Bacteria | 4939 |
| 14 | JGI24702J35022_10001092 | 3300002462 | Bacteria | 16861 |
| 15 | JGI24705J35276_12235665 | 3300002504 | Bacteria | 6809 |
| 16 | Ga0466735_016963 | 3300042624 | Bacteria | 1362 |
| 17 | Ga0466712_039495 | 3300042614 | Bacteria | 22843 |
| 18 | Ga0466712_132586 | 3300042614 | Bacteria | 1936 |
| 19 | Ga0466712_176610 | 3300042614 | Bacteria | 12929 |
| 20 | Ga0466715_438704 | 3300042616 | Bacteria | 8134 |
| 21 | Ga0466718_166815 | 3300042617 | Bacteria | 4285 |
| 22 | Ga0466733_193106 | 3300042659 | Bacteria | 2842 |
| 23 | Ga0222431_1001508 | 3300021190 | Bacteria | 1410 |
| 24 | Ga0264413_111069 | 3300024493 | Bacteria | 5265 |
| 25 | Ga0415639_001688 | 3300038395 | Bacteria | 15097 |
| 26 | Ga0466694_020012 | 3300042594 | Bacteria | 1451 |
| 27 | Ga0466699_163700 | 3300042597 | Bacteria | 58200 |
| 28 | Ga0466698_039108 | 3300042610 | Bacteria | 1283 |
| 29 | Ga0123357_10124850 | 3300009784 | Bacteria | 3228 |
| 30 | Ga0123356_10002899 | 3300010049 | Bacteria | 18170 |
| 31 | Ga0123356_10008377 | 3300010049 | Bacteria | 10282 |
| 32 | Ga0123356_10013620 | 3300010049 | Bacteria | 7839 |
| 33 | Ga0123353_10048645 | 3300010167 | Bacteria | 6753 |
| 34 | Ga0123353_10116765 | 3300010167 | Bacteria | 4294 |
| 35 | Ga0123353_10348231 | 3300010167 | Bacteria | 2234 |
| 36 | Ga0123353_10482900 | 3300010167 | Bacteria | 1812 |
| 37 | JGI24698J34947_10000296 | 3300002449 | Bacteria | 21653 |
| 38 | JGI24698J34947_10014080 | 3300002449 | Bacteria | 4356 |
| 39 | JGI24698J34947_10018093 | 3300002449 | Bacteria | 3812 |
| 40 | JGI24695J34938_10000061 | 3300002450 | Bacteria | 88663 |
| 41 | JGI24695J34938_10001155 | 3300002450 | Bacteria | 23510 |
| 42 | JGI24695J34938_10015210 | 3300002450 | Bacteria | 3954 |
| 43 | JGI24696J40584_12943610 | 3300002834 | Bacteria | 1780 |
| 44 | Ga0072941_1013608 | 3300005201 | Bacteria | 16263 |
| 45 | Ga0072941_1050775 | 3300005201 | Bacteria | 8949 |
| 46 | Ga0466731_286088 | 3300042622 | Bacteria | 1684 |
| 47 | Ga0466727_184231 | 3300042655 | Bacteria | 2500 |
| 48 | Ga0466727_232648 | 3300042655 | Bacteria | 5921 |
| 49 | Ga0466712_048742 | 3300042614 | Bacteria | 29753 |
| 50 | Ga0466712_264940 | 3300042614 | Bacteria | 25363 |
| 51 | Ga0466712_304388 | 3300042614 | Bacteria | 2065 |
| 52 | Ga0466718_089157 | 3300042617 | Bacteria | 5484 |
| 53 | Ga0264413_104591 | 3300024493 | Bacteria | 2933 |
| 54 | Ga0466694_006347 | 3300042594 | Bacteria | 12968 |
| 55 | Ga0466694_147623 | 3300042594 | Bacteria | 4854 |
| 56 | Ga0466694_275655 | 3300042594 | Bacteria | 2086 |
| 57 | Ga0466701_100684 | 3300042598 | Bacteria | 2075 |
| 58 | Ga0466700_424066 | 3300042600 | Bacteria | 5447 |
| 59 | Ga0466720_090347 | 3300042607 | Bacteria | 5924 |
| 60 | Ga0466722_083900 | 3300042609 | Bacteria | 36633 |
| 61 | Ga0123356_10017254 | 3300010049 | Bacteria | 6871 |
| 62 | AustNasuHG_c1003920 | 3300000089 | Bacteria | 5360 |
| 63 | JGI24698J34947_10063681 | 3300002449 | Bacteria | 1806 |
| 64 | JGI24698J34947_10096008 | 3300002449 | Bacteria | 1345 |
| 65 | JGI24695J34938_10000189 | 3300002450 | Bacteria | 57805 |
| 66 | JGI24695J34938_10003649 | 3300002450 | Bacteria | 10565 |
| 67 | JGI24705J35276_12238485 | 3300002504 | Bacteria | 23721 |
| 68 | Ga0072941_1051261 | 3300005201 | Bacteria | 2549 |
| 69 | Ga0466702_115941 | 3300042635 | Bacteria | 2449 |
| 70 | Ga0466702_353692 | 3300042635 | Bacteria | 10001 |
| 71 | Ga0466712_037390 | 3300042614 | Bacteria | 6727 |
| 72 | Ga0466718_005142 | 3300042617 | Bacteria | 1265 |
| 73 | Ga0466718_097805 | 3300042617 | Bacteria | 2297 |
| 74 | Ga0264413_105523 | 3300024493 | Bacteria | 18409 |
| 75 | Ga0415639_021823 | 3300038395 | Bacteria | 6452 |
| 76 | Ga0415639_026360 | 3300038395 | Bacteria | 2831 |
| 77 | Ga0466694_017340 | 3300042594 | Bacteria | 6032 |
| 78 | Ga0466699_112293 | 3300042597 | Bacteria | 7832 |
| 79 | Ga0466699_374690 | 3300042597 | Bacteria | 2616 |
| 80 | Ga0466717_287761 | 3300042604 | Bacteria | 2171 |
| 81 | Ga0466722_008475 | 3300042609 | Bacteria | 1738 |
| 82 | Ga0123356_10006388 | 3300010049 | Bacteria | 11877 |
| 83 | JGI24698J34947_10016567 | 3300002449 | Bacteria | 3998 |
| 84 | JGI24698J34947_10039167 | 3300002449 | Bacteria | 2455 |
| 85 | JGI24695J34938_10000646 | 3300002450 | Bacteria | 33261 |
| 86 | JGI24695J34938_10001266 | 3300002450 | Bacteria | 22194 |
| 87 | JGI24695J34938_10019342 | 3300002450 | Bacteria | 3378 |
| 88 | JGI24695J34938_10023277 | 3300002450 | Bacteria | 2990 |
| 89 | JGI24695J34938_10068805 | 3300002450 | Bacteria | 1486 |
| 90 | Ga0466702_137173 | 3300042635 | Bacteria | 2447 |
| 91 | Ga0466712_237745 | 3300042614 | Bacteria | 17404 |
| 92 | Ga0466732_167304 | 3300042656 | Bacteria | 8608 |
| 93 | Ga0466693_124717 | 3300042592 | Bacteria | 3922 |
| 94 | Ga0466693_204345 | 3300042592 | Bacteria | 6462 |
| 95 | Ga0466694_050950 | 3300042594 | Bacteria | 15465 |
| 96 | Ga0466695_035482 | 3300042595 | Bacteria | 12197 |
| 97 | Ga0466699_042162 | 3300042597 | Bacteria | 13543 |
| 98 | Ga0466714_015876 | 3300042603 | Bacteria | 11383 |
| 99 | Ga0466720_018749 | 3300042607 | Bacteria | 13625 |
| 100 | Ga0123357_10157330 | 3300009784 | Bacteria | 2736 |
| 101 | Ga0123356_10146205 | 3300010049 | Bacteria | 2339 |
| 102 | AustNasuHG_c1000377 | 3300000089 | Bacteria | 15487 |
| 103 | JGI24698J34947_10074424 | 3300002449 | Bacteria | 1618 |
| 104 | JGI24695J34938_10000271 | 3300002450 | Bacteria | 50591 |
| 105 | JGI24695J34938_10003430 | 3300002450 | Bacteria | 11093 |
| 106 | JGI24695J34938_10008553 | 3300002450 | Bacteria | 5822 |
| 107 | JGI24702J35022_10027822 | 3300002462 | Bacteria | 3041 |
| 108 | Ga0072941_1066542 | 3300005201 | Bacteria | 1833 |
| 109 | Ga0466708_054078 | 3300042652 | Bacteria | 6535 |
| 110 | Ga0466712_006953 | 3300042614 | Bacteria | 6149 |
| 111 | Ga0466711_216467 | 3300042615 | Bacteria | 4451 |
| 112 | Ga0466715_142490 | 3300042616 | Bacteria | 66178 |
| 113 | Ga0466718_001240 | 3300042617 | Bacteria | 19118 |
| 114 | Ga0264413_104132 | 3300024493 | Bacteria | 25431 |
| 115 | Ga0466693_005450 | 3300042592 | Bacteria | 32375 |
| 116 | Ga0466691_183984 | 3300042593 | Bacteria | 1767 |
| 117 | Ga0466694_122252 | 3300042594 | Bacteria | 7297 |
| 118 | Ga0466694_177776 | 3300042594 | Bacteria | 7763 |
| 119 | Ga0466699_034112 | 3300042597 | Bacteria | 7331 |
| 120 | Ga0466706_042244 | 3300042599 | Bacteria | 6168 |
| 121 | Ga0466714_107567 | 3300042603 | Unclassified | 1349 |
| 122 | Ga0466717_016913 | 3300042604 | Bacteria | 1598 |
| 123 | Ga0466719_286446 | 3300042606 | Bacteria | 42946 |
| 124 | Ga0466720_094699 | 3300042607 | Bacteria | 1264 |
| 125 | Ga0123353_10002282 | 3300010167 | Bacteria | 23801 |
| 126 | Ga0123353_10235045 | 3300010167 | Bacteria | 2853 |
| 127 | AustNasuHG_c1018724 | 3300000089 | Bacteria | 2280 |
| 128 | JGI24698J34947_10008842 | 3300002449 | Bacteria | 5528 |
| 129 | JGI24698J34947_10097569 | 3300002449 | Bacteria | 1330 |
| 130 | JGI24695J34938_10000829 | 3300002450 | Bacteria | 28754 |
| 131 | JGI24695J34938_10001806 | 3300002450 | Bacteria | 17573 |
| 132 | JGI24695J34938_10004362 | 3300002450 | Bacteria | 9318 |
| 133 | JGI24695J34938_10011750 | 3300002450 | Bacteria | 4697 |
| 134 | JGI24695J34938_10022118 | 3300002450 | Bacteria | 3096 |
| 135 | JGI24705J35276_12233511 | 3300002504 | Bacteria | 4888 |
| 136 | Ga0466702_138200 | 3300042635 | Bacteria | 1579 |
| 137 | Ga0466718_023480 | 3300042617 | Bacteria | 2732 |
| 138 | Ga0264413_100293 | 3300024493 | Bacteria | 21165 |
| 139 | Ga0415639_120875 | 3300038395 | Bacteria | 1272 |
| 140 | Ga0415639_126320 | 3300038395 | Bacteria | 2795 |
| 141 | Ga0466691_127613 | 3300042593 | Bacteria | 9083 |
| 142 | Ga0466695_021732 | 3300042595 | Bacteria | 6775 |
| 143 | Ga0466700_479182 | 3300042600 | Bacteria | 8076 |
| 144 | Ga0466716_350990 | 3300042605 | Bacteria | 8702 |
| 145 | Ga0466720_125620 | 3300042607 | Bacteria | 1717 |
| 146 | Ga0123356_10065164 | 3300010049 | Bacteria | 3408 |
| 147 | JGI24695J34938_10002397 | 3300002450 | Bacteria | 14404 |
| 148 | JGI24695J34938_10006257 | 3300002450 | Bacteria | 7219 |
| 149 | JGI24695J34938_10063182 | 3300002450 | Unclassified | 1570 |
| 150 | JGI24702J35022_10003496 | 3300002462 | Bacteria | 9461 |
| 151 | Ga0072941_1001452 | 3300005201 | Bacteria | 13621 |
| 152 | Ga0466724_17890 | 3300042649 | Bacteria | 3572 |
| 153 | Ga0466723_098825 | 3300042618 | Bacteria | 6111 |
| 154 | Ga0466690_422228 | 3300042590 | Bacteria | 3253 |
| 155 | Ga0466693_135525 | 3300042592 | Bacteria | 26238 |
| 156 | Ga0466694_051705 | 3300042594 | Bacteria | 6151 |
| 157 | Ga0466694_329220 | 3300042594 | Bacteria | 28665 |
| 158 | Ga0466699_016944 | 3300042597 | Bacteria | 1989 |
| 159 | Ga0466714_065927 | 3300042603 | Bacteria | 6669 |
| 160 | Ga0123356_10064439 | 3300010049 | Bacteria | 3426 |
| 161 | AustNasuHG_c1001294 | 3300000089 | Bacteria | 8986 |
| 162 | AustNasuHG_c1027749 | 3300000089 | Bacteria | 1715 |
| 163 | JGI24695J34938_10000053 | 3300002450 | Bacteria | 90544 |
| 164 | JGI24695J34938_10000751 | 3300002450 | Bacteria | 30457 |
| 165 | JGI24695J34938_10001206 | 3300002450 | Bacteria | 22903 |
| 166 | JGI24695J34938_10001216 | 3300002450 | Bacteria | 22813 |
| 167 | JGI24695J34938_10002277 | 3300002450 | Bacteria | 14816 |
| 168 | Ga0072940_1018679 | 3300005200 | Bacteria | 2980 |
| 169 | Ga0466704_110625 | 3300042643 | Bacteria | 2624 |
| 170 | Ga0466712_088158 | 3300042614 | Bacteria | 2162 |
| 171 | Ga0466711_242727 | 3300042615 | Bacteria | 15037 |
| 172 | Ga0466718_005057 | 3300042617 | Bacteria | 1969 |
| 173 | Ga0466718_082024 | 3300042617 | Bacteria | 34669 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF02608 | GO:0005886 | plasma membrane | CC |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.