Protein Family IF06681
Metagenome
Isolate
145
Members
48
Samples
136
Scaffolds
134.62
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_183807|Ga0466720_183807_18_506
- Length
- 162 aa
- Sequence
- MAKGGIVGGACPAAENRGVLVPVEEGCRMKLKRAKDKNFTIPLNSMSDVAFLLLIFIMVIALINFRKEIHIEYATAETVLNTGAEQNLEVWVDIEGNIYIAGDPADIPILEQTVADLYTGAPDTRIHILADRNTPYEKISAVLEVLQILQYRTVSFVVKNAE
Sample Types
Isolate
6.2%
Metagenome
93.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
53.3%
Kalotermitidae
24.4%
Unclassified
20.0%
Hodotermitidae
2.2%
Taxonomy
Archaea
1
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
9
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 2 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 3 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 4 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 5 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 8 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 9 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 10 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 11 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 12 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 13 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 14 | 2781125692 | Treponema sp. Th196P3bin31 | Isolate | Unclassified |
| 15 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 16 | 2781125658 | Treponema sp. Emb289P3bin37 | Isolate | Unclassified |
| 17 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 18 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 19 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 20 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 21 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 22 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 23 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 24 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 25 | 3300001880 | Termite hindgut microbial communities from the Max Planck Institute, Bremen, Germany, analyzing fibers in the hindgut lumen - ASSEMBLED Fiber-Associated Metagenome | Metagenome | |
| 26 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 27 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 28 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 29 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 30 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 31 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 32 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 33 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 34 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 35 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 36 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 37 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 38 | 2781125657 | Treponema sp. Emb289P3bin15 | Isolate | Unclassified |
| 39 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 40 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 41 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 42 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 43 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 44 | 2781125645 | Treponema sp. Co191P3bin32 | Isolate | Unclassified |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 47 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 48 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466706_288536 | 3300042599 | Bacteria | 1698 |
| 2 | Ga0466707_258232 | 3300042601 | Bacteria | 5420 |
| 3 | Ga0466720_116674 | 3300042607 | Bacteria | 1861 |
| 4 | Ga0466720_167154 | 3300042607 | Bacteria | 2977 |
| 5 | Ga0466731_104275 | 3300042622 | Bacteria | 1188 |
| 6 | Ga0466708_450977 | 3300042652 | Bacteria | 1372 |
| 7 | Ga0466694_151362 | 3300042594 | Bacteria | 2595 |
| 8 | Ga0466699_187237 | 3300042597 | Bacteria | 8249 |
| 9 | Ga0123356_11311721 | 3300010049 | Bacteria | 887 |
| 10 | AustNasuHG_c1011840 | 3300000089 | Bacteria | 3020 |
| 11 | JGI24698J34947_10037190 | 3300002449 | Bacteria | 2531 |
| 12 | JGI24699J35502_10604722 | 3300002509 | Bacteria | 685 |
| 13 | Ga0072940_1044270 | 3300005200 | Bacteria | 5337 |
| 14 | Ga0466712_016990 | 3300042614 | Bacteria | 12523 |
| 15 | Ga0466718_054807 | 3300042617 | Bacteria | 1482 |
| 16 | Ga0466718_117288 | 3300042617 | Bacteria | 4320 |
| 17 | Ga0466700_386410 | 3300042600 | Bacteria | 1507 |
| 18 | Ga0466698_264175 | 3300042610 | Bacteria | 5267 |
| 19 | Ga0466709_149610 | 3300042648 | Bacteria | 9158 |
| 20 | Ga0264413_116179 | 3300024493 | Bacteria | 12169 |
| 21 | JGI24698J34947_10095604 | 3300002449 | Archaea | 1350 |
| 22 | JGI24698J34947_10308123 | 3300002449 | Unclassified | 568 |
| 23 | Ga0072940_1018190 | 3300005200 | Bacteria | 3110 |
| 24 | Ga0072940_1027405 | 3300005200 | Bacteria | 3822 |
| 25 | Ga0466732_218063 | 3300042656 | Bacteria | 55897 |
| 26 | Ga0466700_050259 | 3300042600 | Bacteria | 3156 |
| 27 | Ga0466720_096500 | 3300042607 | Bacteria | 25465 |
| 28 | Ga0466720_099821 | 3300042607 | Bacteria | 83537 |
| 29 | Ga0466720_198414 | 3300042607 | Bacteria | 1609 |
| 30 | Ga0466702_127482 | 3300042635 | Bacteria | 6556 |
| 31 | Ga0466702_376079 | 3300042635 | Bacteria | 1377 |
| 32 | Ga0264413_110814 | 3300024493 | Unclassified | 4551 |
| 33 | Ga0466693_205088 | 3300042592 | Bacteria | 3252 |
| 34 | Ga0466694_230555 | 3300042594 | Bacteria | 4479 |
| 35 | Ga0466699_249509 | 3300042597 | Bacteria | 1044 |
| 36 | JGI24698J34947_10002768 | 3300002449 | Bacteria | 9487 |
| 37 | JGI24698J34947_10010286 | 3300002449 | Bacteria | 5129 |
| 38 | JGI24698J34947_10118340 | 3300002449 | Bacteria | 1155 |
| 39 | JGI24695J34938_10092183 | 3300002450 | Bacteria | 1242 |
| 40 | Ga0466711_209387 | 3300042615 | Bacteria | 1154 |
| 41 | Ga0466715_217687 | 3300042616 | Bacteria | 2033 |
| 42 | Ga0466705_118918 | 3300042612 | Bacteria | 1233 |
| 43 | Ga0466705_200097 | 3300042612 | Bacteria | 1009 |
| 44 | Ga0466732_027818 | 3300042656 | Bacteria | 1378 |
| 45 | Ga0466732_263916 | 3300042656 | Bacteria | 9864 |
| 46 | Ga0466720_123392 | 3300042607 | Unclassified | 1044 |
| 47 | Ga0466730_077402 | 3300042625 | Bacteria | 1133 |
| 48 | Ga0264413_116180 | 3300024493 | Bacteria | 6515 |
| 49 | Ga0466691_052551 | 3300042593 | Bacteria | 7492 |
| 50 | Ga0466694_039008 | 3300042594 | Bacteria | 1176 |
| 51 | Ga0466694_375794 | 3300042594 | Bacteria | 1936 |
| 52 | Ga0466699_166495 | 3300042597 | Bacteria | 1203 |
| 53 | Ga0466699_179223 | 3300042597 | Bacteria | 1261 |
| 54 | Ga0466699_240564 | 3300042597 | Bacteria | 1513 |
| 55 | Ga0123356_10001627 | 3300010049 | Bacteria | 24649 |
| 56 | Ga0123353_10709180 | 3300010167 | Bacteria | 1410 |
| 57 | JGI24698J34947_10088862 | 3300002449 | Bacteria | 1424 |
| 58 | JGI24695J34938_10000315 | 3300002450 | Bacteria | 47627 |
| 59 | JGI24695J34938_10018389 | 3300002450 | Bacteria | 3496 |
| 60 | Ga0072940_1161568 | 3300005200 | Bacteria | 1427 |
| 61 | Ga0466711_090953 | 3300042615 | Bacteria | 1538 |
| 62 | Ga0466728_185472 | 3300042620 | Bacteria | 2037 |
| 63 | Ga0466720_055314 | 3300042607 | Bacteria | 3848 |
| 64 | Ga0466721_213888 | 3300042608 | Bacteria | 1747 |
| 65 | Ga0466698_486454 | 3300042610 | Bacteria | 2403 |
| 66 | Ga0466702_443143 | 3300042635 | Bacteria | 8375 |
| 67 | Ga0264413_106982 | 3300024493 | Unclassified | 5099 |
| 68 | Ga0415639_252528 | 3300038395 | Bacteria | 1609 |
| 69 | Ga0466691_147397 | 3300042593 | Bacteria | 2686 |
| 70 | Ga0466699_256075 | 3300042597 | Bacteria | 1277 |
| 71 | Ga0123353_10194079 | 3300010167 | Bacteria | 3202 |
| 72 | Ga0123353_12022574 | 3300010167 | Bacteria | 705 |
| 73 | JGI24698J34947_10029128 | 3300002449 | Bacteria | 2919 |
| 74 | JGI24695J34938_10002269 | 3300002450 | Bacteria | 14854 |
| 75 | JGI24695J34938_10071140 | 3300002450 | Bacteria | 1454 |
| 76 | JGI24695J34938_10394337 | 3300002450 | Bacteria | 616 |
| 77 | JGI24705J35276_11837334 | 3300002504 | Bacteria | 706 |
| 78 | Ga0072940_1094808 | 3300005200 | Unclassified | 4089 |
| 79 | Ga0072941_1007286 | 3300005201 | Bacteria | 4846 |
| 80 | Ga0072941_1049837 | 3300005201 | Bacteria | 6248 |
| 81 | Ga0466718_099143 | 3300042617 | Bacteria | 25542 |
| 82 | Ga0466732_028809 | 3300042656 | Bacteria | 3378 |
| 83 | Ga0466719_295254 | 3300042606 | Bacteria | 26745 |
| 84 | Ga0466719_327683 | 3300042606 | Bacteria | 1419 |
| 85 | Ga0466720_033754 | 3300042607 | Bacteria | 3056 |
| 86 | Ga0466720_034318 | 3300042607 | Bacteria | 32841 |
| 87 | Ga0466720_044105 | 3300042607 | Bacteria | 31294 |
| 88 | Ga0466720_083290 | 3300042607 | Bacteria | 4978 |
| 89 | Ga0466720_197285 | 3300042607 | Bacteria | 4058 |
| 90 | Ga0466702_036383 | 3300042635 | Bacteria | 3043 |
| 91 | Ga0466702_159637 | 3300042635 | Bacteria | 1721 |
| 92 | Ga0466703_108701 | 3300042636 | Bacteria | 1124 |
| 93 | Ga0264413_135757 | 3300024493 | Unclassified | 3954 |
| 94 | Ga0466693_157528 | 3300042592 | Bacteria | 2087 |
| 95 | Ga0466699_238454 | 3300042597 | Bacteria | 9377 |
| 96 | Ga0123356_10000079 | 3300010049 | Bacteria | 103173 |
| 97 | AustNasuHG_c1003835 | 3300000089 | Bacteria | 5415 |
| 98 | AustNasuHG_c1007111 | 3300000089 | Bacteria | 3987 |
| 99 | FAAS_10348495 | 3300001880 | Bacteria | 523 |
| 100 | JGI24698J34947_10068388 | 3300002449 | Bacteria | 1718 |
| 101 | JGI24695J34938_10195520 | 3300002450 | Bacteria | 841 |
| 102 | Ga0072941_1047229 | 3300005201 | Bacteria | 2696 |
| 103 | Ga0466718_088424 | 3300042617 | Bacteria | 3632 |
| 104 | Ga0466723_253111 | 3300042618 | Bacteria | 23254 |
| 105 | Ga0466714_097326 | 3300042603 | Bacteria | 1137 |
| 106 | Ga0466709_074782 | 3300042648 | Bacteria | 1691 |
| 107 | Ga0264413_108716 | 3300024493 | Bacteria | 10282 |
| 108 | Ga0466693_170052 | 3300042592 | Bacteria | 1047 |
| 109 | Ga0123353_10634586 | 3300010167 | Bacteria | 1517 |
| 110 | JGI24698J34947_10148130 | 3300002449 | Bacteria | 979 |
| 111 | JGI24698J34947_10219456 | 3300002449 | Bacteria | 730 |
| 112 | JGI24695J34938_10031154 | 3300002450 | Bacteria | 2478 |
| 113 | JGI24695J34938_10192622 | 3300002450 | Bacteria | 847 |
| 114 | JGI24695J34938_10392447 | 3300002450 | Bacteria | 617 |
| 115 | JGI24699J35502_11008127 | 3300002509 | Bacteria | 1386 |
| 116 | Ga0072941_1027778 | 3300005201 | Bacteria | 16466 |
| 117 | Ga0466700_402131 | 3300042600 | Bacteria | 1375 |
| 118 | Ga0466720_058238 | 3300042607 | Bacteria | 4515 |
| 119 | Ga0466720_063386 | 3300042607 | Bacteria | 7122 |
| 120 | Ga0466720_135826 | 3300042607 | Unclassified | 6278 |
| 121 | Ga0466720_183807 | 3300042607 | Bacteria | 3357 |
| 122 | Ga0466698_378027 | 3300042610 | Bacteria | 1272 |
| 123 | Ga0466704_035569 | 3300042643 | Bacteria | 21995 |
| 124 | Ga0415639_010118 | 3300038395 | Bacteria | 24127 |
| 125 | Ga0466699_128530 | 3300042597 | Bacteria | 2252 |
| 126 | Ga0466699_229850 | 3300042597 | Bacteria | 35684 |
| 127 | Ga0123356_12682674 | 3300010049 | Bacteria | 624 |
| 128 | JGI24698J34947_10002144 | 3300002449 | Bacteria | 10569 |
| 129 | JGI24698J34947_10069151 | 3300002449 | Unclassified | 1705 |
| 130 | JGI24695J34938_10024506 | 3300002450 | Bacteria | 2897 |
| 131 | JGI24702J35022_10012244 | 3300002462 | Bacteria | 4772 |
| 132 | JGI24699J35502_11115663 | 3300002509 | Bacteria | 2928 |
| 133 | Ga0466712_133856 | 3300042614 | Unclassified | 8851 |
| 134 | Ga0466718_010368 | 3300042617 | Bacteria | 37109 |
| 135 | Ga0466718_040277 | 3300042617 | Bacteria | 2661 |
| 136 | Ga0466728_257344 | 3300042620 | Bacteria | 7222 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02472 | ExbD | Biopolymer transport protein ExbD/TolR | 35 | 160 | 0.98 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.