Protein Family IF06648
Metagenome
Isolate
151
Members
40
Samples
147
Scaffolds
201.62
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_098859|Ga0466720_098859_1998_2849
- Length
- 235 aa
- Sequence
- MPNKFAWFLTLAVFSGLSMNLILRFGIGLQCVAPDGDSRDFGKNAKWAFLVWPGIYFISIMLLWLFFSLLQSVLFLGFLEYILVFPVSSLFFTVVEYLVRRLVFTTNWRGETVSRNHFISDHFFIGGLMTGADQASLKSGVSLKPNGVFTGMVGGALFIILGLAGSFAEAVMLSFGFSASTALAVLIIGEIRRRSAMEAVPDWLRGDPLILVAMGLLSLVFISAALVFYAVLGVN
Sample Types
Isolate
2.6%
Metagenome
97.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
50.0%
Kalotermitidae
23.7%
Unclassified
10.5%
Rhinotermitidae
7.9%
Termopsidae
7.9%
Taxonomy
Archaea
0
Bacteria
135
Eukaryota
0
Viruses
0
Unclassified
16
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 2 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 3 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 4 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 5 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 6 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 7 | 2781125696 | Treponema sp. Th196P4bin22 | Isolate | Unclassified |
| 8 | 2819992462 | Unclassified Spirochaetes Nc150P4bin14 | Isolate | Unclassified |
| 9 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 10 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 11 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 12 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300005485 | Termite gut microbial communities from Costa Rica - P3 luminal contents | Metagenome | Termitidae |
| 15 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 16 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 17 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 18 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 19 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 20 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 21 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 22 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 23 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 24 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 25 | 2820020240 | Unclassified Spirochaetes Nc150P3bin10 | Isolate | Unclassified |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 38 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 39 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 40 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_109779 | 3300042656 | Bacteria | 2042 |
| 2 | Ga0466735_062391 | 3300042624 | Bacteria | 2288 |
| 3 | Ga0466699_083260 | 3300042597 | Bacteria | 1239 |
| 4 | Ga0466720_031121 | 3300042607 | Bacteria | 38472 |
| 5 | Ga0466720_068956 | 3300042607 | Bacteria | 1685 |
| 6 | Ga0466720_085805 | 3300042607 | Bacteria | 20784 |
| 7 | Ga0466720_114349 | 3300042607 | Bacteria | 3129 |
| 8 | Ga0466722_045759 | 3300042609 | Unclassified | 14974 |
| 9 | JGI24698J34947_10007450 | 3300002449 | Bacteria | 6018 |
| 10 | JGI24698J34947_10194836 | 3300002449 | Unclassified | 799 |
| 11 | JGI24695J34938_10082912 | 3300002450 | Bacteria | 1323 |
| 12 | Ga0072940_1044134 | 3300005200 | Bacteria | 6222 |
| 13 | Ga0074263_114414 | 3300005485 | Bacteria | 1404 |
| 14 | Ga0466712_160681 | 3300042614 | Bacteria | 9107 |
| 15 | Ga0466712_249007 | 3300042614 | Bacteria | 23113 |
| 16 | Ga0466711_095782 | 3300042615 | Bacteria | 5184 |
| 17 | Ga0466718_000270 | 3300042617 | Bacteria | 14891 |
| 18 | Ga0466718_082810 | 3300042617 | Bacteria | 20578 |
| 19 | Ga0466718_127309 | 3300042617 | Unclassified | 1099 |
| 20 | Ga0466723_031241 | 3300042618 | Bacteria | 3618 |
| 21 | Ga0466726_344857 | 3300042619 | Bacteria | 1207 |
| 22 | Ga0264413_104067 | 3300024493 | Bacteria | 8333 |
| 23 | Ga0264413_104371 | 3300024493 | Bacteria | 5149 |
| 24 | Ga0466692_108178 | 3300042591 | Bacteria | 1658 |
| 25 | Ga0466694_015256 | 3300042594 | Bacteria | 5006 |
| 26 | Ga0466720_103552 | 3300042607 | Bacteria | 4299 |
| 27 | Ga0466722_005883 | 3300042609 | Bacteria | 11792 |
| 28 | Ga0466722_081475 | 3300042609 | Bacteria | 12768 |
| 29 | Ga0123356_10074661 | 3300010049 | Bacteria | 3191 |
| 30 | JGI24698J34947_10005981 | 3300002449 | Bacteria | 6677 |
| 31 | JGI24698J34947_10094897 | 3300002449 | Bacteria | 1358 |
| 32 | JGI24695J34938_10001579 | 3300002450 | Bacteria | 19187 |
| 33 | JGI24696J40584_12889573 | 3300002834 | Unclassified | 1123 |
| 34 | Ga0072940_1046075 | 3300005200 | Bacteria | 8358 |
| 35 | Ga0072941_1059905 | 3300005201 | Bacteria | 12148 |
| 36 | Ga0466732_181260 | 3300042656 | Unclassified | 1379 |
| 37 | Ga0466732_249285 | 3300042656 | Bacteria | 5950 |
| 38 | Ga0466732_282592 | 3300042656 | Bacteria | 22717 |
| 39 | Ga0466727_171738 | 3300042655 | Bacteria | 1874 |
| 40 | Ga0466712_040686 | 3300042614 | Bacteria | 6529 |
| 41 | Ga0264413_104372 | 3300024493 | Bacteria | 2885 |
| 42 | Ga0264413_111369 | 3300024493 | Unclassified | 2358 |
| 43 | Ga0264413_115099 | 3300024493 | Bacteria | 7019 |
| 44 | Ga0264413_115156 | 3300024493 | Bacteria | 2688 |
| 45 | Ga0466693_382196 | 3300042592 | Bacteria | 1276 |
| 46 | Ga0466694_085819 | 3300042594 | Bacteria | 2161 |
| 47 | Ga0466694_288612 | 3300042594 | Bacteria | 28574 |
| 48 | Ga0466694_350040 | 3300042594 | Bacteria | 1666 |
| 49 | Ga0466700_012593 | 3300042600 | Bacteria | 1610 |
| 50 | Ga0466720_023844 | 3300042607 | Bacteria | 8743 |
| 51 | Ga0466720_052404 | 3300042607 | Bacteria | 3092 |
| 52 | Ga0466720_098859 | 3300042607 | Bacteria | 6548 |
| 53 | Ga0466722_164924 | 3300042609 | Bacteria | 5761 |
| 54 | Ga0466698_034489 | 3300042610 | Bacteria | 5895 |
| 55 | Ga0123353_10854630 | 3300010167 | Bacteria | 1247 |
| 56 | JGI24698J34947_10001075 | 3300002449 | Bacteria | 14060 |
| 57 | JGI24698J34947_10020180 | 3300002449 | Bacteria | 3593 |
| 58 | JGI24698J34947_10034048 | 3300002449 | Bacteria | 2669 |
| 59 | Ga0074263_106465 | 3300005485 | Bacteria | 2184 |
| 60 | Ga0466705_049931 | 3300042612 | Bacteria | 17901 |
| 61 | Ga0466705_316834 | 3300042612 | Bacteria | 7211 |
| 62 | Ga0466732_292397 | 3300042656 | Bacteria | 4191 |
| 63 | Ga0466732_395211 | 3300042656 | Bacteria | 10882 |
| 64 | Ga0466712_277830 | 3300042614 | Bacteria | 2988 |
| 65 | Ga0466715_334725 | 3300042616 | Bacteria | 6902 |
| 66 | Ga0466715_644135 | 3300042616 | Bacteria | 18712 |
| 67 | Ga0466718_096793 | 3300042617 | Bacteria | 35781 |
| 68 | Ga0466694_083030 | 3300042594 | Bacteria | 3712 |
| 69 | Ga0466694_394462 | 3300042594 | Unclassified | 2714 |
| 70 | Ga0466719_335710 | 3300042606 | Bacteria | 7356 |
| 71 | Ga0466720_002541 | 3300042607 | Bacteria | 7837 |
| 72 | Ga0466720_025899 | 3300042607 | Bacteria | 56735 |
| 73 | Ga0466720_077184 | 3300042607 | Bacteria | 10113 |
| 74 | Ga0466720_124576 | 3300042607 | Bacteria | 12727 |
| 75 | Ga0466722_002665 | 3300042609 | Bacteria | 2964 |
| 76 | Ga0123353_11913852 | 3300010167 | Unclassified | 731 |
| 77 | JGI24698J34947_10075657 | 3300002449 | Bacteria | 1600 |
| 78 | JGI24695J34938_10013355 | 3300002450 | Bacteria | 4316 |
| 79 | Ga0072940_1350787 | 3300005200 | Bacteria | 1325 |
| 80 | Ga0466704_419736 | 3300042643 | Bacteria | 23463 |
| 81 | Ga0466709_120704 | 3300042648 | Unclassified | 21016 |
| 82 | Ga0466712_317248 | 3300042614 | Bacteria | 1093 |
| 83 | Ga0466711_229246 | 3300042615 | Bacteria | 24636 |
| 84 | Ga0466715_272431 | 3300042616 | Bacteria | 5285 |
| 85 | Ga0466723_042811 | 3300042618 | Unclassified | 11929 |
| 86 | Ga0466723_305085 | 3300042618 | Bacteria | 1765 |
| 87 | Ga0264413_103199 | 3300024493 | Bacteria | 5919 |
| 88 | Ga0466692_093033 | 3300042591 | Bacteria | 23120 |
| 89 | Ga0466699_424862 | 3300042597 | Bacteria | 31048 |
| 90 | Ga0466720_194926 | 3300042607 | Bacteria | 30039 |
| 91 | Ga0123353_11539544 | 3300010167 | Bacteria | 844 |
| 92 | Ga0123354_10266218 | 3300010882 | Bacteria | 1698 |
| 93 | AustNasuHG_c1003872 | 3300000089 | Bacteria | 5390 |
| 94 | JGI24698J34947_10086077 | 3300002449 | Bacteria | 1458 |
| 95 | JGI24695J34938_10030330 | 3300002450 | Bacteria | 2519 |
| 96 | JGI24695J34938_10078556 | 3300002450 | Bacteria | 1366 |
| 97 | JGI24695J34938_10201204 | 3300002450 | Bacteria | 830 |
| 98 | JGI24702J35022_10004725 | 3300002462 | Bacteria | 8058 |
| 99 | JGI24702J35022_10017164 | 3300002462 | Bacteria | 3960 |
| 100 | Ga0072940_1054473 | 3300005200 | Bacteria | 1808 |
| 101 | Ga0072941_1002481 | 3300005201 | Bacteria | 14656 |
| 102 | Ga0072941_1048520 | 3300005201 | Bacteria | 16084 |
| 103 | Ga0072941_1089967 | 3300005201 | Bacteria | 11304 |
| 104 | Ga0074263_101438 | 3300005485 | Bacteria | 1383 |
| 105 | Ga0466705_236602 | 3300042612 | Bacteria | 26817 |
| 106 | Ga0466715_135767 | 3300042616 | Bacteria | 8383 |
| 107 | Ga0466715_506335 | 3300042616 | Unclassified | 1005 |
| 108 | Ga0264413_111368 | 3300024493 | Unclassified | 1395 |
| 109 | Ga0466692_122261 | 3300042591 | Bacteria | 3411 |
| 110 | Ga0466716_125246 | 3300042605 | Bacteria | 8412 |
| 111 | Ga0466720_037684 | 3300042607 | Bacteria | 18264 |
| 112 | Ga0466720_084306 | 3300042607 | Unclassified | 1572 |
| 113 | Ga0466720_187784 | 3300042607 | Unclassified | 1056 |
| 114 | Ga0466722_109568 | 3300042609 | Bacteria | 3829 |
| 115 | Ga0466722_188073 | 3300042609 | Bacteria | 2960 |
| 116 | JGI24698J34947_10004904 | 3300002449 | Bacteria | 7330 |
| 117 | Ga0072940_1023729 | 3300005200 | Bacteria | 9318 |
| 118 | Ga0072941_1012990 | 3300005201 | Bacteria | 4134 |
| 119 | Ga0072941_1183625 | 3300005201 | Bacteria | 5752 |
| 120 | Ga0466705_053318 | 3300042612 | Bacteria | 4243 |
| 121 | Ga0466705_348211 | 3300042612 | Bacteria | 4844 |
| 122 | Ga0466732_331635 | 3300042656 | Bacteria | 1041 |
| 123 | Ga0466735_003136 | 3300042624 | Bacteria | 1803 |
| 124 | Ga0466704_167337 | 3300042643 | Bacteria | 117281 |
| 125 | Ga0466711_136655 | 3300042615 | Bacteria | 32231 |
| 126 | Ga0264413_104156 | 3300024493 | Bacteria | 2661 |
| 127 | Ga0466690_153703 | 3300042590 | Bacteria | 8366 |
| 128 | Ga0466722_214322 | 3300042609 | Bacteria | 13374 |
| 129 | Ga0466722_257546 | 3300042609 | Bacteria | 5804 |
| 130 | Ga0123353_10064910 | 3300010167 | Bacteria | 5859 |
| 131 | JGI24698J34947_10017107 | 3300002449 | Unclassified | 3933 |
| 132 | JGI24695J34938_10000365 | 3300002450 | Bacteria | 44882 |
| 133 | Ga0072941_1009610 | 3300005201 | Bacteria | 3154 |
| 134 | Ga0072941_1018504 | 3300005201 | Bacteria | 23366 |
| 135 | Ga0466729_310792 | 3300042621 | Bacteria | 1675 |
| 136 | Ga0466704_050691 | 3300042643 | Bacteria | 3610 |
| 137 | Ga0466712_024328 | 3300042614 | Bacteria | 42619 |
| 138 | Ga0466715_101080 | 3300042616 | Bacteria | 7515 |
| 139 | Ga0466715_159020 | 3300042616 | Bacteria | 3144 |
| 140 | Ga0466729_084151 | 3300042621 | Unclassified | 1361 |
| 141 | Ga0466694_380207 | 3300042594 | Bacteria | 1116 |
| 142 | Ga0466720_152558 | 3300042607 | Bacteria | 11649 |
| 143 | Ga0123353_10971920 | 3300010167 | Bacteria | 1145 |
| 144 | Ga0123353_11260371 | 3300010167 | Bacteria | 964 |
| 145 | JGI24695J34938_10012012 | 3300002450 | Bacteria | 4618 |
| 146 | Ga0072940_1096215 | 3300005200 | Bacteria | 2309 |
| 147 | Ga0074263_100995 | 3300005485 | Bacteria | 5148 |
MSA Aligner
Geographic Distribution
Some samples may be missing due to lack of coordinate data.