Protein Family IF06642
Metagenome
Metatranscriptome
Isolate
125
Members
39
Samples
123
Scaffolds
174.1
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_085547|Ga0466720_085547_464_1066
- Length
- 200 aa
- Sequence
- MYFDRIFFIFLFCIFYDNFVFKERKVNEAVMYAKYNQAANKAILDLLKKLNNDDRERDRGSFYGSLSGLFRHVLGSIRFFLGMYKTALGGNAAALKAISAIETLPEFPEGSLNETQWNELQSAATVIDTAYIAMAQALNASDLSLPVKTAWYGGNPASVPLSFMLSQLVVHNTHHRGQISQILDSMVIANDYSGIDVSFL
Sample Types
Isolate
1.6%
Metagenome
97.6%
MAG
0.0%
Metatranscriptome
0.8%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
40.5%
Kalotermitidae
35.1%
Unclassified
8.1%
Rhinotermitidae
8.1%
Termopsidae
8.1%
Taxonomy
Archaea
2
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
5
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 6 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 7 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 8 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 9 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 10 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 11 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 12 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 13 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 14 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 15 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 16 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 17 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 20 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 21 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 22 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 23 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 24 | 3300021239 | Termite gut microbial communities from nest from French Guiana - FG16_17_4 mRNA SA | Metatranscriptome | |
| 25 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 2781125631 | Treponema sp. Nt197P3bin89 | Isolate | Unclassified |
| 28 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 29 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 30 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 31 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 32 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 33 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 34 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 35 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 36 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 37 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 38 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466732_027843 | 3300042656 | Bacteria | 3228 |
| 2 | Ga0466732_281350 | 3300042656 | Bacteria | 4788 |
| 3 | Ga0466705_442698 | 3300042612 | Bacteria | 3449 |
| 4 | Ga0466718_006478 | 3300042617 | Bacteria | 44889 |
| 5 | Ga0466716_330047 | 3300042605 | Bacteria | 3191 |
| 6 | Ga0466722_096401 | 3300042609 | Bacteria | 1629 |
| 7 | AustNasuHG_c1058321 | 3300000089 | Bacteria | 764 |
| 8 | Ga0466702_024429 | 3300042635 | Bacteria | 1797 |
| 9 | Ga0466708_166110 | 3300042652 | Bacteria | 5103 |
| 10 | Ga0264413_117629 | 3300024493 | Bacteria | 4366 |
| 11 | Ga0466692_125052 | 3300042591 | Bacteria | 28079 |
| 12 | Ga0466691_092417 | 3300042593 | Bacteria | 1500 |
| 13 | Ga0466694_171898 | 3300042594 | Bacteria | 1659 |
| 14 | Ga0466699_174872 | 3300042597 | Bacteria | 3442 |
| 15 | Ga0466699_256373 | 3300042597 | Bacteria | 1422 |
| 16 | Ga0466705_102075 | 3300042612 | Bacteria | 1014 |
| 17 | Ga0466711_082019 | 3300042615 | Bacteria | 7020 |
| 18 | Ga0466715_271746 | 3300042616 | Bacteria | 8350 |
| 19 | Ga0466715_519613 | 3300042616 | Bacteria | 6989 |
| 20 | Ga0466718_002239 | 3300042617 | Bacteria | 4843 |
| 21 | Ga0466718_138997 | 3300042617 | Unclassified | 11910 |
| 22 | Ga0466719_133151 | 3300042606 | Bacteria | 1170 |
| 23 | Ga0466720_085547 | 3300042607 | Bacteria | 4033 |
| 24 | Ga0466720_228515 | 3300042607 | Bacteria | 2364 |
| 25 | Ga0072940_1105237 | 3300005200 | Bacteria | 1141 |
| 26 | Ga0466704_310515 | 3300042643 | Bacteria | 1096 |
| 27 | Ga0466704_425636 | 3300042643 | Bacteria | 27682 |
| 28 | Ga0466708_040166 | 3300042652 | Bacteria | 2589 |
| 29 | Ga0466692_056617 | 3300042591 | Bacteria | 76518 |
| 30 | Ga0466694_199098 | 3300042594 | Bacteria | 7152 |
| 31 | Ga0466696_153535 | 3300042596 | Bacteria | 5922 |
| 32 | Ga0466705_193608 | 3300042612 | Bacteria | 1763 |
| 33 | Ga0466732_215404 | 3300042656 | Bacteria | 1481 |
| 34 | Ga0466711_176325 | 3300042615 | Bacteria | 3878 |
| 35 | Ga0466715_060672 | 3300042616 | Bacteria | 14896 |
| 36 | Ga0466718_002642 | 3300042617 | Bacteria | 4009 |
| 37 | Ga0466720_077951 | 3300042607 | Unclassified | 2658 |
| 38 | Ga0466698_215742 | 3300042610 | Bacteria | 1088 |
| 39 | AustNasuHG_c1002711 | 3300000089 | Bacteria | 6387 |
| 40 | JGI24695J34938_10031539 | 3300002450 | Archaea | 2458 |
| 41 | Ga0466735_171727 | 3300042624 | Bacteria | 1101 |
| 42 | Ga0466704_207177 | 3300042643 | Bacteria | 2552 |
| 43 | Ga0456237_0004559 | 3300041968 | Bacteria | 2223 |
| 44 | Ga0466723_030584 | 3300042618 | Bacteria | 6922 |
| 45 | Ga0466723_071736 | 3300042618 | Bacteria | 57252 |
| 46 | Ga0466726_075911 | 3300042619 | Bacteria | 2212 |
| 47 | Ga0466720_079984 | 3300042607 | Bacteria | 7179 |
| 48 | JGI24698J34947_10041083 | 3300002449 | Bacteria | 2384 |
| 49 | Ga0072940_1043415 | 3300005200 | Bacteria | 4460 |
| 50 | Ga0264413_131425 | 3300024493 | Bacteria | 6022 |
| 51 | Ga0466694_303431 | 3300042594 | Bacteria | 1644 |
| 52 | Ga0466699_206699 | 3300042597 | Unclassified | 2222 |
| 53 | Ga0466705_207963 | 3300042612 | Bacteria | 6658 |
| 54 | Ga0466732_455907 | 3300042656 | Bacteria | 4250 |
| 55 | Ga0466715_105055 | 3300042616 | Bacteria | 2402 |
| 56 | Ga0466718_170154 | 3300042617 | Bacteria | 4482 |
| 57 | Ga0466723_059040 | 3300042618 | Bacteria | 3871 |
| 58 | Ga0466726_176552 | 3300042619 | Bacteria | 1056 |
| 59 | Ga0466720_074797 | 3300042607 | Bacteria | 8674 |
| 60 | Ga0466720_092813 | 3300042607 | Bacteria | 7868 |
| 61 | Ga0466722_203595 | 3300042609 | Bacteria | 2354 |
| 62 | Ga0072940_1065839 | 3300005200 | Bacteria | 3269 |
| 63 | Ga0466702_326647 | 3300042635 | Bacteria | 4945 |
| 64 | Ga0466702_388867 | 3300042635 | Bacteria | 1976 |
| 65 | Ga0466727_208083 | 3300042655 | Bacteria | 1272 |
| 66 | Ga0466694_167907 | 3300042594 | Bacteria | 4786 |
| 67 | Ga0466699_080409 | 3300042597 | Bacteria | 2249 |
| 68 | Ga0466699_251342 | 3300042597 | Bacteria | 1037 |
| 69 | Ga0123354_10187077 | 3300010882 | Bacteria | 2337 |
| 70 | Ga0466711_387402 | 3300042615 | Bacteria | 1458 |
| 71 | Ga0466715_046174 | 3300042616 | Bacteria | 30258 |
| 72 | Ga0466718_023512 | 3300042617 | Bacteria | 6605 |
| 73 | Ga0466718_080987 | 3300042617 | Bacteria | 2437 |
| 74 | Ga0466718_135867 | 3300042617 | Bacteria | 1082 |
| 75 | Ga0466717_084155 | 3300042604 | Bacteria | 1029 |
| 76 | Ga0466719_130367 | 3300042606 | Bacteria | 2602 |
| 77 | Ga0466719_442331 | 3300042606 | Bacteria | 4186 |
| 78 | Ga0466720_001295 | 3300042607 | Bacteria | 32202 |
| 79 | Ga0466720_117535 | 3300042607 | Bacteria | 20172 |
| 80 | Ga0466702_111493 | 3300042635 | Bacteria | 3447 |
| 81 | Ga0466704_286001 | 3300042643 | Bacteria | 16185 |
| 82 | Ga0466708_365586 | 3300042652 | Bacteria | 2184 |
| 83 | Ga0223677_1013471 | 3300021239 | Archaea | 2154 |
| 84 | Ga0264413_122255 | 3300024493 | Bacteria | 2200 |
| 85 | Ga0466690_195850 | 3300042590 | Bacteria | 1584 |
| 86 | Ga0466691_202850 | 3300042593 | Bacteria | 3547 |
| 87 | Ga0466699_007342 | 3300042597 | Bacteria | 1609 |
| 88 | Ga0466699_060884 | 3300042597 | Bacteria | 2022 |
| 89 | Ga0466699_189630 | 3300042597 | Bacteria | 1622 |
| 90 | Ga0466705_126746 | 3300042612 | Bacteria | 23522 |
| 91 | Ga0466705_222720 | 3300042612 | Bacteria | 18831 |
| 92 | Ga0466732_015118 | 3300042656 | Bacteria | 10235 |
| 93 | Ga0466732_021219 | 3300042656 | Bacteria | 2759 |
| 94 | Ga0466732_355253 | 3300042656 | Bacteria | 5780 |
| 95 | Ga0466733_192556 | 3300042659 | Bacteria | 11796 |
| 96 | Ga0466715_145171 | 3300042616 | Bacteria | 8955 |
| 97 | Ga0466718_092716 | 3300042617 | Bacteria | 1691 |
| 98 | Ga0466726_294306 | 3300042619 | Bacteria | 1058 |
| 99 | Ga0466720_017690 | 3300042607 | Bacteria | 1010 |
| 100 | Ga0466698_317103 | 3300042610 | Bacteria | 1462 |
| 101 | AustNasuHG_c1023796 | 3300000089 | Bacteria | 1950 |
| 102 | JGI24702J35022_10392649 | 3300002462 | Bacteria | 836 |
| 103 | Ga0466704_195868 | 3300042643 | Bacteria | 6648 |
| 104 | Ga0466704_397736 | 3300042643 | Unclassified | 1339 |
| 105 | Ga0264413_114711 | 3300024493 | Bacteria | 3694 |
| 106 | Ga0456237_0002856 | 3300041968 | Bacteria | 2802 |
| 107 | Ga0466692_042170 | 3300042591 | Bacteria | 4545 |
| 108 | Ga0466699_192770 | 3300042597 | Bacteria | 2346 |
| 109 | Ga0466699_230918 | 3300042597 | Bacteria | 2404 |
| 110 | Ga0466705_194079 | 3300042612 | Bacteria | 1558 |
| 111 | Ga0466732_000487 | 3300042656 | Bacteria | 17316 |
| 112 | Ga0466705_520939 | 3300042612 | Unclassified | 1263 |
| 113 | Ga0466718_030347 | 3300042617 | Bacteria | 17552 |
| 114 | Ga0466718_042441 | 3300042617 | Bacteria | 8555 |
| 115 | Ga0466726_356363 | 3300042619 | Bacteria | 3232 |
| 116 | Ga0466707_012168 | 3300042601 | Bacteria | 1395 |
| 117 | Ga0466702_324209 | 3300042635 | Bacteria | 11014 |
| 118 | Ga0466703_185732 | 3300042636 | Bacteria | 1096 |
| 119 | Ga0466704_104942 | 3300042643 | Bacteria | 1151 |
| 120 | Ga0466709_163067 | 3300042648 | Bacteria | 7259 |
| 121 | Ga0466694_068600 | 3300042594 | Bacteria | 1505 |
| 122 | Ga0466699_323934 | 3300042597 | Bacteria | 2862 |
| 123 | Ga0466699_412648 | 3300042597 | Bacteria | 3016 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF05163 | DinB | DinB family | 31 | 184 | 0.89 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.