Protein Family IF06610
Metagenome
Isolate
151
Members
50
Samples
145
Scaffolds
270.58
Avg Length
Representative Sequence
- ID
- 3300042607|Ga0466720_015938|Ga0466720_015938_71_1018
- Length
- 315 aa
- Sequence
- MPSVLSVIVQTFIFPVLPIFTLINDNKITDIQYMVRGWYTAVSGMRAQQWRLDAVANNLANVDTEGFKREQAAFKAFPELLLRRMKDDGQYPHPFGSGDAAPIIGKLGTGVELNELFVSFEQGALKETQSDFDIALDGKGFLAVSTPWGERYTRNGSFQLGKEGFLETKEGYPVMGENGPIRVKANNFQIDKEGRIWINAEYDDDPNVLVSREGNSWSDPVLLDILKVVDFDIDRYLKKQGSSLYYETETSGPAMIMDEENRPKVIQGFVEAANVEPVREMVQMIEVNRAYEANQKVIQTHDTMLGVLINQVAKV
Sample Types
Isolate
4.0%
Metagenome
96.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
39.6%
Kalotermitidae
29.2%
Unclassified
14.6%
Rhinotermitidae
8.3%
Termopsidae
6.2%
Blaberidae
2.1%
Taxonomy
Archaea
0
Bacteria
138
Eukaryota
0
Viruses
0
Unclassified
13
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 2 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 3 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 4 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 5 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 6 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 7 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 8 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 15 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 16 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 17 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 18 | 2781125652 | Treponema sp. Cu122P5bin1 | Isolate | Unclassified |
| 19 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 20 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 21 | 3300042635 | Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 | Metagenome | Termitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 25 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 26 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 27 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 28 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 29 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 30 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 31 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 32 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 33 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 34 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 35 | 2781125694 | Treponema sp. Th196P3bin120 | Isolate | Unclassified |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 38 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 39 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 40 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 41 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 42 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 43 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 44 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 45 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 46 | 3300042604 | Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 | Metagenome | Termitidae |
| 47 | 3300042610 | Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 | Metagenome | Termitidae |
| 48 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 49 | 2781125635 | Treponema sp. Co191P1bin60 | Isolate | Unclassified |
| 50 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_142073 | 3300042612 | Bacteria | 1855 |
| 2 | Ga0466735_102690 | 3300042624 | Bacteria | 1496 |
| 3 | Ga0466713_135942 | 3300042602 | Unclassified | 3288 |
| 4 | Ga0466715_095204 | 3300042616 | Bacteria | 3908 |
| 5 | Ga0466715_487126 | 3300042616 | Bacteria | 1014 |
| 6 | Ga0466723_053524 | 3300042618 | Bacteria | 25546 |
| 7 | Ga0466723_198298 | 3300042618 | Bacteria | 6081 |
| 8 | Ga0466690_118221 | 3300042590 | Bacteria | 39842 |
| 9 | Ga0466693_118734 | 3300042592 | Bacteria | 1119 |
| 10 | Ga0123353_10357171 | 3300010167 | Bacteria | 2198 |
| 11 | JGI24695J34938_10000393 | 3300002450 | Bacteria | 43110 |
| 12 | JGI24695J34938_10158797 | 3300002450 | Bacteria | 929 |
| 13 | JGI24702J35022_10000258 | 3300002462 | Bacteria | 30271 |
| 14 | Ga0466732_128725 | 3300042656 | Bacteria | 1287 |
| 15 | Ga0466705_364477 | 3300042612 | Bacteria | 1606 |
| 16 | Ga0466731_149982 | 3300042622 | Bacteria | 1302 |
| 17 | Ga0466731_211028 | 3300042622 | Bacteria | 1239 |
| 18 | Ga0466735_035560 | 3300042624 | Bacteria | 9001 |
| 19 | Ga0466704_156935 | 3300042643 | Bacteria | 7102 |
| 20 | Ga0466704_485048 | 3300042643 | Bacteria | 5988 |
| 21 | Ga0466704_527222 | 3300042643 | Bacteria | 45743 |
| 22 | Ga0466709_001356 | 3300042648 | Bacteria | 34748 |
| 23 | Ga0466709_039908 | 3300042648 | Bacteria | 10024 |
| 24 | Ga0466713_024535 | 3300042602 | Bacteria | 10841 |
| 25 | Ga0466719_194160 | 3300042606 | Bacteria | 2125 |
| 26 | Ga0466719_256372 | 3300042606 | Bacteria | 2573 |
| 27 | Ga0466719_359764 | 3300042606 | Unclassified | 1504 |
| 28 | Ga0466712_120010 | 3300042614 | Bacteria | 41166 |
| 29 | Ga0466711_371133 | 3300042615 | Bacteria | 1197 |
| 30 | Ga0466723_068138 | 3300042618 | Bacteria | 16894 |
| 31 | Ga0466690_067522 | 3300042590 | Bacteria | 7773 |
| 32 | Ga0466691_054844 | 3300042593 | Unclassified | 6408 |
| 33 | Ga0466691_075246 | 3300042593 | Bacteria | 9950 |
| 34 | Ga0466696_074618 | 3300042596 | Bacteria | 4037 |
| 35 | Ga0466696_257278 | 3300042596 | Bacteria | 6272 |
| 36 | Ga0466699_092734 | 3300042597 | Bacteria | 9948 |
| 37 | AustNasuHG_c1021223 | 3300000089 | Bacteria | 2105 |
| 38 | Ga0466731_216874 | 3300042622 | Bacteria | 1547 |
| 39 | Ga0466703_009613 | 3300042636 | Unclassified | 3343 |
| 40 | Ga0466704_216804 | 3300042643 | Bacteria | 12927 |
| 41 | Ga0466709_289286 | 3300042648 | Bacteria | 1449 |
| 42 | Ga0466708_271342 | 3300042652 | Bacteria | 15719 |
| 43 | Ga0466727_058528 | 3300042655 | Bacteria | 2239 |
| 44 | Ga0466698_293880 | 3300042610 | Bacteria | 1742 |
| 45 | Ga0466698_368020 | 3300042610 | Bacteria | 1728 |
| 46 | Ga0466718_015683 | 3300042617 | Bacteria | 1569 |
| 47 | Ga0466723_164428 | 3300042618 | Bacteria | 8703 |
| 48 | Ga0466728_024100 | 3300042620 | Bacteria | 13352 |
| 49 | Ga0466690_281172 | 3300042590 | Bacteria | 2932 |
| 50 | Ga0466690_307023 | 3300042590 | Bacteria | 2472 |
| 51 | Ga0466691_201235 | 3300042593 | Bacteria | 22831 |
| 52 | Ga0466696_314889 | 3300042596 | Bacteria | 4494 |
| 53 | Ga0123353_10077005 | 3300010167 | Bacteria | 5360 |
| 54 | Ga0123353_10159088 | 3300010167 | Bacteria | 3598 |
| 55 | Ga0466733_157708 | 3300042659 | Bacteria | 1025 |
| 56 | Ga0466705_322638 | 3300042612 | Bacteria | 1180 |
| 57 | Ga0466703_131235 | 3300042636 | Bacteria | 3707 |
| 58 | Ga0466717_198141 | 3300042604 | Bacteria | 1544 |
| 59 | Ga0466716_063844 | 3300042605 | Unclassified | 5565 |
| 60 | Ga0466719_172995 | 3300042606 | Bacteria | 4386 |
| 61 | Ga0466719_225450 | 3300042606 | Bacteria | 68670 |
| 62 | Ga0466698_288804 | 3300042610 | Unclassified | 1954 |
| 63 | Ga0466715_386228 | 3300042616 | Bacteria | 2407 |
| 64 | Ga0415639_118084 | 3300038395 | Bacteria | 5486 |
| 65 | Ga0466690_146011 | 3300042590 | Bacteria | 3455 |
| 66 | Ga0466691_140938 | 3300042593 | Bacteria | 30510 |
| 67 | Ga0466695_054925 | 3300042595 | Bacteria | 6471 |
| 68 | Ga0466696_300468 | 3300042596 | Bacteria | 2514 |
| 69 | Ga0068305_10054277 | 3300005083 | Bacteria | 3587 |
| 70 | Ga0466732_153999 | 3300042656 | Bacteria | 24228 |
| 71 | Ga0466703_043426 | 3300042636 | Unclassified | 2807 |
| 72 | Ga0466704_014195 | 3300042643 | Unclassified | 2161 |
| 73 | Ga0466704_301981 | 3300042643 | Unclassified | 1564 |
| 74 | Ga0466700_262847 | 3300042600 | Bacteria | 4294 |
| 75 | Ga0466717_116034 | 3300042604 | Bacteria | 1256 |
| 76 | Ga0466716_253587 | 3300042605 | Bacteria | 3774 |
| 77 | Ga0466711_008388 | 3300042615 | Bacteria | 30567 |
| 78 | Ga0466723_046372 | 3300042618 | Bacteria | 32767 |
| 79 | Ga0466726_214276 | 3300042619 | Bacteria | 3260 |
| 80 | Ga0466728_043035 | 3300042620 | Bacteria | 3636 |
| 81 | Ga0466728_094661 | 3300042620 | Bacteria | 12988 |
| 82 | Ga0466728_195090 | 3300042620 | Bacteria | 2100 |
| 83 | Ga0264413_101799 | 3300024493 | Bacteria | 45782 |
| 84 | Ga0466692_168843 | 3300042591 | Bacteria | 4159 |
| 85 | JGI24695J34938_10001516 | 3300002450 | Bacteria | 19556 |
| 86 | JGI24702J35022_10005087 | 3300002462 | Bacteria | 7730 |
| 87 | Ga0072941_1137566 | 3300005201 | Bacteria | 1490 |
| 88 | Ga0466732_190384 | 3300042656 | Bacteria | 3248 |
| 89 | Ga0466729_239884 | 3300042621 | Bacteria | 2511 |
| 90 | Ga0466702_395905 | 3300042635 | Bacteria | 1472 |
| 91 | Ga0466703_003480 | 3300042636 | Bacteria | 2146 |
| 92 | Ga0466709_258825 | 3300042648 | Bacteria | 56335 |
| 93 | Ga0466716_100915 | 3300042605 | Bacteria | 19964 |
| 94 | Ga0466711_100127 | 3300042615 | Bacteria | 14318 |
| 95 | Ga0466718_001891 | 3300042617 | Bacteria | 1562 |
| 96 | Ga0466726_031273 | 3300042619 | Bacteria | 7623 |
| 97 | Ga0466726_122952 | 3300042619 | Bacteria | 2888 |
| 98 | Ga0466728_084727 | 3300042620 | Bacteria | 4461 |
| 99 | Ga0456237_0001224 | 3300041968 | Bacteria | 4066 |
| 100 | Ga0466690_039034 | 3300042590 | Bacteria | 1265 |
| 101 | Ga0466694_228362 | 3300042594 | Bacteria | 7367 |
| 102 | Ga0466699_406022 | 3300042597 | Bacteria | 1011 |
| 103 | Ga0072941_1017156 | 3300005201 | Bacteria | 7102 |
| 104 | Ga0466732_057848 | 3300042656 | Bacteria | 8247 |
| 105 | Ga0466705_342511 | 3300042612 | Bacteria | 2711 |
| 106 | Ga0466703_100791 | 3300042636 | Bacteria | 25625 |
| 107 | Ga0466708_041724 | 3300042652 | Bacteria | 12518 |
| 108 | Ga0466708_175972 | 3300042652 | Bacteria | 43390 |
| 109 | Ga0466708_198450 | 3300042652 | Bacteria | 1127 |
| 110 | Ga0466700_166802 | 3300042600 | Bacteria | 1453 |
| 111 | Ga0466719_040399 | 3300042606 | Unclassified | 14944 |
| 112 | Ga0466720_015938 | 3300042607 | Bacteria | 1307 |
| 113 | Ga0466720_069500 | 3300042607 | Bacteria | 18398 |
| 114 | Ga0466722_035175 | 3300042609 | Bacteria | 7319 |
| 115 | Ga0466698_096614 | 3300042610 | Bacteria | 39797 |
| 116 | Ga0466705_432836 | 3300042612 | Unclassified | 1833 |
| 117 | Ga0466715_031553 | 3300042616 | Bacteria | 1145 |
| 118 | Ga0466715_245983 | 3300042616 | Bacteria | 27497 |
| 119 | Ga0466718_067550 | 3300042617 | Bacteria | 1130 |
| 120 | Ga0466726_035156 | 3300042619 | Bacteria | 3053 |
| 121 | Ga0466726_315926 | 3300042619 | Bacteria | 1005 |
| 122 | Ga0466726_429782 | 3300042619 | Bacteria | 2447 |
| 123 | Ga0466728_177222 | 3300042620 | Bacteria | 5778 |
| 124 | Ga0466728_370956 | 3300042620 | Bacteria | 2410 |
| 125 | Ga0466690_033977 | 3300042590 | Bacteria | 20675 |
| 126 | Ga0466690_048923 | 3300042590 | Bacteria | 2868 |
| 127 | Ga0466696_060680 | 3300042596 | Unclassified | 12096 |
| 128 | Ga0466696_071315 | 3300042596 | Bacteria | 3420 |
| 129 | Ga0466696_213145 | 3300042596 | Bacteria | 4123 |
| 130 | JGI24695J34938_10009929 | 3300002450 | Bacteria | 5253 |
| 131 | Ga0466705_322351 | 3300042612 | Bacteria | 18531 |
| 132 | Ga0466704_134435 | 3300042643 | Bacteria | 44988 |
| 133 | Ga0466708_211379 | 3300042652 | Unclassified | 2527 |
| 134 | Ga0466716_317184 | 3300042605 | Bacteria | 4285 |
| 135 | Ga0466716_467205 | 3300042605 | Bacteria | 3961 |
| 136 | Ga0466719_519108 | 3300042606 | Bacteria | 4851 |
| 137 | Ga0466723_059819 | 3300042618 | Bacteria | 8638 |
| 138 | Ga0466726_339340 | 3300042619 | Bacteria | 2248 |
| 139 | Ga0466726_402401 | 3300042619 | Bacteria | 5167 |
| 140 | Ga0466696_186318 | 3300042596 | Bacteria | 24052 |
| 141 | Ga0466699_079133 | 3300042597 | Bacteria | 1923 |
| 142 | Ga0466699_367461 | 3300042597 | Bacteria | 1263 |
| 143 | AustNasuHG_c1016383 | 3300000089 | Bacteria | 2481 |
| 144 | JGI24702J35022_10050129 | 3300002462 | Bacteria | 2224 |
| 145 | Ga0068305_10232216 | 3300005083 | Bacteria | 7534 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.