Protein Family IF06589
Metagenome
Isolate
117
Members
28
Samples
115
Scaffolds
454.64
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_472712|Ga0466719_472712_120_1586
- Length
- 457 aa
- Sequence
- MQEVTQGRIDQIIFVEVPLGDCRFRVLLVRLPDYMKIPPLFNDRRFYKSLFAIAVPIMLQNLITSLGNQIFFLYNLTLFGICSGGTIFTAQFWGKGDIRGIRKNMGFCMTLSLLAALFYTLGALFIPEELIGIYSRDPEVIRSGAVYLRTLAPSFVPFGISMVFVLTLRSVEKVRLAIVATLVALSQNGVLNYLFIFGAGPIPPMGVQGAALATVISRYTEVLILLTVTYARRYPPAGSLRELFAFNSLYARRFFKIALPVICNEVIWSLGVSCQNLIFARTHTDAIAAFNITNTMSNLAWVVFIGLGNGVAVLIGKQIGKGDEQSARDYASRIVRFAPLLSLGALFLLVFNVKAGVLAATGQMFFVLACSYPFRAFNISMVVGICRAGGDTVFCIFYDIALMWLLSLPLAAAAGFIFHAPVWLIYICISSEEPFKMLLGIWRLKTGKWLRHVTEGV
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
50.0%
Rhinotermitidae
14.3%
Termitidae
14.3%
Termopsidae
10.7%
Unclassified
7.1%
Blaberidae
3.6%
Taxonomy
Archaea
0
Bacteria
113
Eukaryota
0
Viruses
0
Unclassified
4
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 2 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 3 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 4 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 5 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 6 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 7 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 8 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 9 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 10 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 11 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 12 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 13 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 14 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 15 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 18 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 19 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 20 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 21 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 22 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 23 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 24 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 25 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 26 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 27 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 28 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_116677 | 3300042612 | Bacteria | 17201 |
| 2 | Ga0466705_228082 | 3300042612 | Unclassified | 1941 |
| 3 | Ga0466711_007659 | 3300042615 | Bacteria | 15807 |
| 4 | Ga0466715_020408 | 3300042616 | Bacteria | 5842 |
| 5 | Ga0466715_024181 | 3300042616 | Bacteria | 4530 |
| 6 | Ga0466715_032470 | 3300042616 | Bacteria | 17892 |
| 7 | Ga0466715_035934 | 3300042616 | Bacteria | 6497 |
| 8 | Ga0466715_224279 | 3300042616 | Bacteria | 16535 |
| 9 | Ga0466723_006778 | 3300042618 | Bacteria | 11756 |
| 10 | Ga0466723_112797 | 3300042618 | Bacteria | 2952 |
| 11 | Ga0466728_250660 | 3300042620 | Bacteria | 2078 |
| 12 | Ga0466719_079503 | 3300042606 | Bacteria | 17293 |
| 13 | Ga0466719_534540 | 3300042606 | Bacteria | 8440 |
| 14 | Ga0466722_209995 | 3300042609 | Bacteria | 2538 |
| 15 | Ga0466722_260256 | 3300042609 | Bacteria | 4954 |
| 16 | Ga0466708_144720 | 3300042652 | Bacteria | 6983 |
| 17 | Ga0466708_369908 | 3300042652 | Bacteria | 4105 |
| 18 | Ga0466727_033254 | 3300042655 | Bacteria | 5912 |
| 19 | Ga0466727_179055 | 3300042655 | Bacteria | 1547 |
| 20 | Ga0466711_192602 | 3300042615 | Bacteria | 12297 |
| 21 | Ga0466715_391990 | 3300042616 | Bacteria | 3226 |
| 22 | Ga0466715_399048 | 3300042616 | Bacteria | 5025 |
| 23 | Ga0466723_046564 | 3300042618 | Bacteria | 3362 |
| 24 | Ga0466723_087714 | 3300042618 | Bacteria | 9855 |
| 25 | Ga0466723_140640 | 3300042618 | Bacteria | 2222 |
| 26 | Ga0466726_307134 | 3300042619 | Bacteria | 3776 |
| 27 | Ga0466707_026084 | 3300042601 | Bacteria | 3452 |
| 28 | Ga0466722_014310 | 3300042609 | Bacteria | 20425 |
| 29 | Ga0466722_091211 | 3300042609 | Bacteria | 4731 |
| 30 | Ga0466722_197559 | 3300042609 | Bacteria | 3822 |
| 31 | Ga0466708_079899 | 3300042652 | Bacteria | 17009 |
| 32 | Ga0466708_092108 | 3300042652 | Bacteria | 10527 |
| 33 | Ga0466708_250415 | 3300042652 | Bacteria | 26600 |
| 34 | Ga0466691_055628 | 3300042593 | Bacteria | 38394 |
| 35 | Ga0466691_061109 | 3300042593 | Bacteria | 4528 |
| 36 | Ga0466694_379188 | 3300042594 | Bacteria | 3001 |
| 37 | Ga0466705_395264 | 3300042612 | Bacteria | 39488 |
| 38 | Ga0466711_006306 | 3300042615 | Bacteria | 6694 |
| 39 | Ga0466715_473978 | 3300042616 | Bacteria | 8486 |
| 40 | Ga0466715_549513 | 3300042616 | Bacteria | 6204 |
| 41 | Ga0466726_429311 | 3300042619 | Bacteria | 2765 |
| 42 | Ga0466728_405979 | 3300042620 | Bacteria | 5099 |
| 43 | Ga0466707_279275 | 3300042601 | Bacteria | 2088 |
| 44 | Ga0466707_336532 | 3300042601 | Bacteria | 2239 |
| 45 | Ga0466719_269874 | 3300042606 | Bacteria | 19174 |
| 46 | Ga0466719_472712 | 3300042606 | Bacteria | 1774 |
| 47 | Ga0466704_067513 | 3300042643 | Bacteria | 11515 |
| 48 | Ga0466704_544521 | 3300042643 | Bacteria | 6497 |
| 49 | Ga0466690_047580 | 3300042590 | Bacteria | 1896 |
| 50 | Ga0466692_018076 | 3300042591 | Bacteria | 4327 |
| 51 | Ga0466691_169148 | 3300042593 | Bacteria | 3150 |
| 52 | Ga0466705_155404 | 3300042612 | Bacteria | 22638 |
| 53 | Ga0466733_221180 | 3300042659 | Bacteria | 1529 |
| 54 | Ga0466726_428562 | 3300042619 | Bacteria | 2461 |
| 55 | Ga0466707_399518 | 3300042601 | Bacteria | 8031 |
| 56 | Ga0466716_239695 | 3300042605 | Bacteria | 7573 |
| 57 | Ga0466716_269803 | 3300042605 | Bacteria | 15033 |
| 58 | Ga0466735_013584 | 3300042624 | Bacteria | 8069 |
| 59 | Ga0466703_105009 | 3300042636 | Bacteria | 2825 |
| 60 | Ga0466704_054232 | 3300042643 | Bacteria | 2582 |
| 61 | Ga0466727_278661 | 3300042655 | Bacteria | 4959 |
| 62 | Ga0466690_247631 | 3300042590 | Bacteria | 1804 |
| 63 | Ga0466692_047323 | 3300042591 | Bacteria | 10281 |
| 64 | Ga0466691_039573 | 3300042593 | Bacteria | 2680 |
| 65 | Ga0466715_439056 | 3300042616 | Bacteria | 1926 |
| 66 | Ga0466707_266464 | 3300042601 | Bacteria | 3096 |
| 67 | Ga0466716_463468 | 3300042605 | Bacteria | 1939 |
| 68 | Ga0466722_019242 | 3300042609 | Bacteria | 7524 |
| 69 | Ga0466703_141911 | 3300042636 | Bacteria | 2085 |
| 70 | Ga0466704_408425 | 3300042643 | Bacteria | 3386 |
| 71 | Ga0466709_054508 | 3300042648 | Bacteria | 5637 |
| 72 | Ga0466708_019565 | 3300042652 | Bacteria | 7468 |
| 73 | Ga0466690_109498 | 3300042590 | Bacteria | 5097 |
| 74 | Ga0466691_049590 | 3300042593 | Bacteria | 1650 |
| 75 | Ga0466696_247301 | 3300042596 | Bacteria | 9063 |
| 76 | Ga0466696_290580 | 3300042596 | Bacteria | 1736 |
| 77 | Ga0466705_169012 | 3300042612 | Bacteria | 2519 |
| 78 | Ga0466711_153163 | 3300042615 | Bacteria | 6634 |
| 79 | Ga0466715_028714 | 3300042616 | Bacteria | 4814 |
| 80 | Ga0466729_100103 | 3300042621 | Bacteria | 2025 |
| 81 | Ga0466716_202023 | 3300042605 | Bacteria | 9942 |
| 82 | Ga0466719_115739 | 3300042606 | Bacteria | 3363 |
| 83 | Ga0466719_258260 | 3300042606 | Bacteria | 4375 |
| 84 | Ga0466719_426099 | 3300042606 | Bacteria | 12622 |
| 85 | Ga0466722_249555 | 3300042609 | Unclassified | 4630 |
| 86 | Ga0466729_278157 | 3300042621 | Bacteria | 1720 |
| 87 | Ga0466704_502212 | 3300042643 | Bacteria | 3525 |
| 88 | Ga0466708_158435 | 3300042652 | Bacteria | 10344 |
| 89 | Ga0456237_0000657 | 3300041968 | Bacteria | 5286 |
| 90 | Ga0466690_027527 | 3300042590 | Bacteria | 1714 |
| 91 | Ga0466692_120362 | 3300042591 | Bacteria | 1719 |
| 92 | Ga0123357_10147914 | 3300009784 | Bacteria | 2862 |
| 93 | Ga0466711_088873 | 3300042615 | Bacteria | 9597 |
| 94 | Ga0466711_198077 | 3300042615 | Bacteria | 3590 |
| 95 | Ga0466715_484268 | 3300042616 | Bacteria | 2530 |
| 96 | Ga0466723_239859 | 3300042618 | Bacteria | 4513 |
| 97 | Ga0466700_292087 | 3300042600 | Bacteria | 3572 |
| 98 | Ga0466707_101198 | 3300042601 | Bacteria | 2492 |
| 99 | Ga0466703_263649 | 3300042636 | Bacteria | 8238 |
| 100 | Ga0466704_476763 | 3300042643 | Bacteria | 3292 |
| 101 | Ga0466709_249528 | 3300042648 | Bacteria | 4631 |
| 102 | Ga0466727_011876 | 3300042655 | Bacteria | 20083 |
| 103 | Ga0466692_121959 | 3300042591 | Unclassified | 1516 |
| 104 | Ga0466705_141754 | 3300042612 | Bacteria | 2784 |
| 105 | Ga0466726_075111 | 3300042619 | Bacteria | 6584 |
| 106 | Ga0466728_084727 | 3300042620 | Bacteria | 4461 |
| 107 | Ga0466728_173178 | 3300042620 | Bacteria | 1804 |
| 108 | Ga0466719_527509 | 3300042606 | Bacteria | 10509 |
| 109 | Ga0466722_135246 | 3300042609 | Bacteria | 2068 |
| 110 | Ga0466703_093613 | 3300042636 | Bacteria | 15503 |
| 111 | Ga0466709_273110 | 3300042648 | Bacteria | 6786 |
| 112 | Ga0466708_333759 | 3300042652 | Unclassified | 11262 |
| 113 | Ga0466708_445684 | 3300042652 | Bacteria | 8130 |
| 114 | Ga0466727_060413 | 3300042655 | Bacteria | 6252 |
| 115 | Ga0466696_364564 | 3300042596 | Bacteria | 6730 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.