Protein Family IF06571
Metagenome
Isolate
133
Members
30
Samples
130
Scaffolds
361.81
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_371202|Ga0466719_371202_2613_3890
- Length
- 425 aa
- Sequence
- VKTGFAEAGQGLMDSREPVRVPLLNRALQSKDTELRRREEKMKKIPVADAIPCSGGLHHPIPRFGELRRTAVVLCTVLLSAAFALSGCSGKPAEGAAASGQETGSKQLNIYCWTYYVPLSVREKFEQEYNVTIIFDEYDSNESMYTKIQAGGGGYDLVFPSGDYVSIMINQGMFEKIDKSKLSNLGNIDPLVLEKTTYDPKMEYSVPYYFGAAGIAVNTARVPDFEKSWSIFGRGDLRGRMTMLDDMREVMGDALVHLGYSVNSKNPAEIAAAQDLINNRWKPNLVKFDAEAPGKGFATGDFWVIQGYAEMVFEEITAEQKEDTVFFIPPEGGPAYIDSMCILKGAEHPDLAHKFIDFIHRPEIYAEFTDYFGFPATVNVPARALKKVTPYYTAEELLRTELKDDLGEELELYNDVWFGSIRVGD
Sample Types
Isolate
2.3%
Metagenome
97.7%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
50.0%
Termitidae
16.7%
Unclassified
10.0%
Rhinotermitidae
10.0%
Termopsidae
10.0%
Hodotermitidae
3.3%
Taxonomy
Archaea
0
Bacteria
127
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 2 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 3 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 4 | 2781125695 | Treponema sp. Th196P4bin30 | Isolate | Unclassified |
| 5 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 6 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 7 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 8 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 9 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 10 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 11 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 12 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 13 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 14 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 15 | 2503904012 | Sphaerochaeta coccoides SPN1, DSM 17374 | Isolate | Kalotermitidae |
| 16 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 17 | 2781125683 | Treponema sp. Lab288P1bin34 | Isolate | Unclassified |
| 18 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 19 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 20 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 21 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 22 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 23 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 27 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 28 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 29 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 30 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466691_117863 | 3300042593 | Bacteria | 11001 |
| 2 | Ga0466696_184611 | 3300042596 | Bacteria | 7063 |
| 3 | Ga0466711_013491 | 3300042615 | Bacteria | 22993 |
| 4 | Ga0466700_340142 | 3300042600 | Bacteria | 4382 |
| 5 | Ga0466716_091669 | 3300042605 | Bacteria | 15022 |
| 6 | Ga0466716_148140 | 3300042605 | Bacteria | 2176 |
| 7 | Ga0466716_234638 | 3300042605 | Bacteria | 4093 |
| 8 | Ga0466719_205443 | 3300042606 | Bacteria | 2890 |
| 9 | Ga0466719_371202 | 3300042606 | Bacteria | 5154 |
| 10 | Ga0466705_203330 | 3300042612 | Bacteria | 1924 |
| 11 | Ga0466703_413966 | 3300042636 | Bacteria | 2019 |
| 12 | Ga0466704_119510 | 3300042643 | Bacteria | 7918 |
| 13 | Ga0466708_210151 | 3300042652 | Bacteria | 4242 |
| 14 | Ga0466708_214236 | 3300042652 | Bacteria | 6277 |
| 15 | Ga0466690_302753 | 3300042590 | Bacteria | 4477 |
| 16 | Ga0466692_118332 | 3300042591 | Bacteria | 20260 |
| 17 | Ga0466691_022852 | 3300042593 | Bacteria | 5809 |
| 18 | Ga0466696_142470 | 3300042596 | Bacteria | 16471 |
| 19 | Ga0466696_296865 | 3300042596 | Unclassified | 6609 |
| 20 | Ga0466711_167327 | 3300042615 | Bacteria | 4991 |
| 21 | Ga0466711_223566 | 3300042615 | Bacteria | 33529 |
| 22 | Ga0466715_261164 | 3300042616 | Bacteria | 3110 |
| 23 | Ga0466723_145596 | 3300042618 | Bacteria | 1879 |
| 24 | Ga0466723_219645 | 3300042618 | Bacteria | 34348 |
| 25 | Ga0466728_044806 | 3300042620 | Bacteria | 2738 |
| 26 | Ga0466729_058188 | 3300042621 | Bacteria | 2485 |
| 27 | Ga0068305_10016036 | 3300005083 | Bacteria | 6335 |
| 28 | Ga0466705_309849 | 3300042612 | Bacteria | 1702 |
| 29 | Ga0466703_154284 | 3300042636 | Bacteria | 3706 |
| 30 | Ga0466704_446015 | 3300042643 | Bacteria | 11198 |
| 31 | Ga0466708_025908 | 3300042652 | Bacteria | 28237 |
| 32 | Ga0466708_026361 | 3300042652 | Bacteria | 5998 |
| 33 | Ga0466696_399345 | 3300042596 | Bacteria | 4542 |
| 34 | Ga0466699_210683 | 3300042597 | Bacteria | 2074 |
| 35 | Ga0466705_435884 | 3300042612 | Bacteria | 5739 |
| 36 | Ga0466715_030598 | 3300042616 | Bacteria | 1733 |
| 37 | Ga0466715_193133 | 3300042616 | Bacteria | 1594 |
| 38 | Ga0466715_373544 | 3300042616 | Bacteria | 7917 |
| 39 | Ga0466726_000668 | 3300042619 | Bacteria | 1960 |
| 40 | Ga0466726_220758 | 3300042619 | Bacteria | 8368 |
| 41 | Ga0466719_153440 | 3300042606 | Bacteria | 2629 |
| 42 | Ga0466719_377536 | 3300042606 | Bacteria | 3587 |
| 43 | Ga0466719_405011 | 3300042606 | Bacteria | 11341 |
| 44 | Ga0466729_248258 | 3300042621 | Bacteria | 1833 |
| 45 | Ga0466703_232237 | 3300042636 | Bacteria | 3986 |
| 46 | Ga0466703_302781 | 3300042636 | Bacteria | 7782 |
| 47 | Ga0466704_075070 | 3300042643 | Bacteria | 10097 |
| 48 | Ga0466704_154048 | 3300042643 | Bacteria | 6787 |
| 49 | Ga0466704_253487 | 3300042643 | Bacteria | 36226 |
| 50 | Ga0466704_603765 | 3300042643 | Bacteria | 11375 |
| 51 | Ga0466708_017665 | 3300042652 | Bacteria | 9029 |
| 52 | Ga0466690_165979 | 3300042590 | Bacteria | 10936 |
| 53 | Ga0466690_184112 | 3300042590 | Unclassified | 2801 |
| 54 | Ga0466690_218063 | 3300042590 | Bacteria | 3963 |
| 55 | Ga0466690_243966 | 3300042590 | Bacteria | 7676 |
| 56 | Ga0466691_048049 | 3300042593 | Bacteria | 15319 |
| 57 | Ga0466705_400836 | 3300042612 | Bacteria | 2980 |
| 58 | Ga0466711_077159 | 3300042615 | Bacteria | 12050 |
| 59 | Ga0466726_263882 | 3300042619 | Bacteria | 2028 |
| 60 | Ga0466706_120136 | 3300042599 | Bacteria | 49312 |
| 61 | Ga0466716_121392 | 3300042605 | Bacteria | 28760 |
| 62 | Ga0466722_006015 | 3300042609 | Bacteria | 10617 |
| 63 | Ga0466705_043730 | 3300042612 | Bacteria | 4661 |
| 64 | Ga0466735_152168 | 3300042624 | Bacteria | 3944 |
| 65 | Ga0466703_124879 | 3300042636 | Bacteria | 4676 |
| 66 | Ga0466703_151744 | 3300042636 | Bacteria | 2655 |
| 67 | Ga0466704_619639 | 3300042643 | Bacteria | 5156 |
| 68 | Ga0466709_234721 | 3300042648 | Bacteria | 3867 |
| 69 | Ga0466709_388029 | 3300042648 | Bacteria | 5251 |
| 70 | Ga0466708_027043 | 3300042652 | Bacteria | 16443 |
| 71 | Ga0466727_070577 | 3300042655 | Bacteria | 10459 |
| 72 | Ga0466696_172508 | 3300042596 | Bacteria | 36754 |
| 73 | Ga0466699_345017 | 3300042597 | Bacteria | 1794 |
| 74 | Ga0466715_338778 | 3300042616 | Bacteria | 7273 |
| 75 | Ga0466723_046140 | 3300042618 | Bacteria | 5976 |
| 76 | Ga0466726_263577 | 3300042619 | Unclassified | 8169 |
| 77 | Ga0466728_132280 | 3300042620 | Bacteria | 14722 |
| 78 | Ga0466716_290743 | 3300042605 | Bacteria | 8011 |
| 79 | Ga0466719_125626 | 3300042606 | Bacteria | 6928 |
| 80 | Ga0466719_261841 | 3300042606 | Bacteria | 1568 |
| 81 | Ga0466722_037533 | 3300042609 | Bacteria | 21759 |
| 82 | JGI24702J35022_10025516 | 3300002462 | Bacteria | 3189 |
| 83 | Ga0466705_297622 | 3300042612 | Bacteria | 8316 |
| 84 | Ga0466703_144259 | 3300042636 | Bacteria | 4333 |
| 85 | Ga0466703_209417 | 3300042636 | Bacteria | 3738 |
| 86 | Ga0466704_218057 | 3300042643 | Bacteria | 2421 |
| 87 | Ga0466704_248553 | 3300042643 | Bacteria | 5675 |
| 88 | Ga0466704_281492 | 3300042643 | Unclassified | 2452 |
| 89 | Ga0466704_346675 | 3300042643 | Bacteria | 2287 |
| 90 | Ga0466708_047151 | 3300042652 | Bacteria | 15429 |
| 91 | Ga0466708_051670 | 3300042652 | Bacteria | 10993 |
| 92 | Ga0466708_324648 | 3300042652 | Bacteria | 2560 |
| 93 | Ga0466727_151122 | 3300042655 | Bacteria | 3328 |
| 94 | Ga0466694_043546 | 3300042594 | Bacteria | 51657 |
| 95 | Ga0466699_188588 | 3300042597 | Bacteria | 15998 |
| 96 | Ga0466699_224893 | 3300042597 | Bacteria | 2027 |
| 97 | Ga0466718_025688 | 3300042617 | Bacteria | 8125 |
| 98 | Ga0466726_384187 | 3300042619 | Bacteria | 3101 |
| 99 | Ga0466716_379267 | 3300042605 | Bacteria | 13955 |
| 100 | Ga0466703_053792 | 3300042636 | Bacteria | 16450 |
| 101 | Ga0466704_193218 | 3300042643 | Bacteria | 13736 |
| 102 | Ga0466704_291864 | 3300042643 | Bacteria | 8148 |
| 103 | Ga0466704_543813 | 3300042643 | Bacteria | 7486 |
| 104 | Ga0466696_234915 | 3300042596 | Bacteria | 2065 |
| 105 | Ga0466696_300320 | 3300042596 | Bacteria | 5113 |
| 106 | Ga0466711_045228 | 3300042615 | Bacteria | 17013 |
| 107 | Ga0466715_175309 | 3300042616 | Bacteria | 6102 |
| 108 | Ga0466715_254665 | 3300042616 | Bacteria | 14218 |
| 109 | Ga0466723_026644 | 3300042618 | Bacteria | 4981 |
| 110 | Ga0466728_054193 | 3300042620 | Bacteria | 11218 |
| 111 | Ga0466728_386444 | 3300042620 | Bacteria | 4934 |
| 112 | Ga0466719_079584 | 3300042606 | Bacteria | 1965 |
| 113 | Ga0466705_058970 | 3300042612 | Bacteria | 7409 |
| 114 | Ga0466705_210210 | 3300042612 | Bacteria | 14341 |
| 115 | Ga0466704_133879 | 3300042643 | Bacteria | 16498 |
| 116 | Ga0466709_025162 | 3300042648 | Bacteria | 5757 |
| 117 | Ga0466708_291933 | 3300042652 | Bacteria | 12676 |
| 118 | Ga0466691_079205 | 3300042593 | Bacteria | 8030 |
| 119 | Ga0466715_463476 | 3300042616 | Bacteria | 3491 |
| 120 | Ga0466728_376504 | 3300042620 | Bacteria | 6572 |
| 121 | Ga0466719_028910 | 3300042606 | Unclassified | 2346 |
| 122 | Ga0466719_077646 | 3300042606 | Bacteria | 15106 |
| 123 | Ga0466719_494074 | 3300042606 | Bacteria | 7829 |
| 124 | Ga0466703_393097 | 3300042636 | Unclassified | 2857 |
| 125 | Ga0466704_203783 | 3300042643 | Bacteria | 23097 |
| 126 | Ga0466709_093744 | 3300042648 | Bacteria | 6398 |
| 127 | Ga0466709_296378 | 3300042648 | Bacteria | 8043 |
| 128 | Ga0466708_346674 | 3300042652 | Bacteria | 11228 |
| 129 | Ga0466727_235821 | 3300042655 | Bacteria | 1419 |
| 130 | Ga0466727_299127 | 3300042655 | Bacteria | 2059 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF13416 | SBP_bac_8 | Bacterial extracellular solute-binding protein | 123 | 378 | 0.88 |
| PF13531 | SBP_bac_11 | Bacterial extracellular solute-binding protein | 122 | 371 | 0.87 |
| PF13343 | SBP_bac_6 | Bacterial extracellular solute-binding protein | 162 | 380 | 0.79 |
| PF01547 | SBP_bac_1 | Bacterial extracellular solute-binding protein | 121 | 363 | 0.77 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.