Protein Family IF06565
Metagenome
Isolate
130
Members
39
Samples
126
Scaffolds
300.18
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_353451|Ga0466719_353451_934_1926
- Length
- 330 aa
- Sequence
- LIFFANIPKEALYLQEGFSDFRFSTSNYQSAIINQQLQLATTNIAFILNPVSGAKQKRKIPLLIRRFFTYGKGFRVTFYRTKAAGDATVMAKKFADENYDIVVAIGGDGTVNEVAQALVNTNTALGIVPVGSGNGLARHLHIPMNPCKALRHIATAKTCRADYGLMNGIPFFCTAGVGFDALIGNRFAQANSRGFATYLRKILREFVLYKPEEYNLTIDGKAMRRKAFLITFANASQWGNNAYIAPTASVSDGLLDVVVLSKFPLYRAPNIGLRLFTRQIDKLRYIEIFRCRSAAVDRVNSGYIHYDGEPSQTGKHVEVKLVQGALKIVS
Sample Types
Isolate
3.1%
Metagenome
96.9%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
27.0%
Termopsidae
10.8%
Unclassified
10.8%
Rhinotermitidae
8.1%
Elmidae
2.7%
Passalidae
2.7%
Taxonomy
Archaea
0
Bacteria
123
Eukaryota
0
Viruses
0
Unclassified
7
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 2 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 3 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 4 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 5 | 3300042654 | Termite gut microbial communities of Promirotermes sp. from Ebogo II, Mbalmayo, Cameroon - Pmx449 | Metagenome | Termitidae |
| 6 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 7 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 8 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 9 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 10 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 11 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 12 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 13 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 14 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 15 | 2864836148 | Arcicella rosea S00070 | Isolate | Elmidae |
| 16 | 2820781750 | Unclassified Bacteroidetes Emb289P3bin89 | Isolate | Unclassified |
| 17 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042608 | Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 | Metagenome | Termitidae |
| 20 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 21 | 3300002449 | Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 | Metagenome | Termitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042598 | Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 | Metagenome | Termitidae |
| 25 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 26 | 2820748953 | Unclassified Bacteroidetes Nt197P4bin17 | Isolate | Unclassified |
| 27 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 31 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 32 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 33 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 34 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 35 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 36 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 37 | 2820772500 | Unclassified Bacteroidetes Lab288P1bin72 | Isolate | Unclassified |
| 38 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 39 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_135310 | 3300042612 | Bacteria | 16326 |
| 2 | Ga0123353_10301251 | 3300010167 | Bacteria | 2447 |
| 3 | Ga0466691_007727 | 3300042593 | Bacteria | 6350 |
| 4 | Ga0466691_049444 | 3300042593 | Bacteria | 8307 |
| 5 | Ga0466696_004260 | 3300042596 | Bacteria | 14834 |
| 6 | Ga0466696_069457 | 3300042596 | Bacteria | 4385 |
| 7 | Ga0072941_1153562 | 3300005201 | Bacteria | 2974 |
| 8 | Ga0466722_029205 | 3300042609 | Bacteria | 12757 |
| 9 | Ga0466703_138229 | 3300042636 | Bacteria | 4282 |
| 10 | Ga0466704_154752 | 3300042643 | Bacteria | 10999 |
| 11 | Ga0466708_046334 | 3300042652 | Bacteria | 5095 |
| 12 | Ga0123356_10055991 | 3300010049 | Bacteria | 3673 |
| 13 | Ga0466690_363310 | 3300042590 | Bacteria | 7394 |
| 14 | Ga0466691_091844 | 3300042593 | Bacteria | 8001 |
| 15 | Ga0466691_119216 | 3300042593 | Bacteria | 6096 |
| 16 | Ga0466696_471991 | 3300042596 | Bacteria | 8662 |
| 17 | Ga0466723_164021 | 3300042618 | Bacteria | 38027 |
| 18 | Ga0466726_387149 | 3300042619 | Bacteria | 5604 |
| 19 | Ga0466719_317563 | 3300042606 | Bacteria | 2745 |
| 20 | Ga0466722_173646 | 3300042609 | Bacteria | 9212 |
| 21 | Ga0466708_070580 | 3300042652 | Bacteria | 12677 |
| 22 | Ga0466708_254328 | 3300042652 | Bacteria | 25412 |
| 23 | Ga0466692_098494 | 3300042591 | Bacteria | 22280 |
| 24 | Ga0466692_153897 | 3300042591 | Bacteria | 2302 |
| 25 | Ga0466691_075227 | 3300042593 | Bacteria | 47930 |
| 26 | Ga0466705_479348 | 3300042612 | Bacteria | 1869 |
| 27 | Ga0466715_135674 | 3300042616 | Bacteria | 34654 |
| 28 | JGI24702J35022_10006761 | 3300002462 | Bacteria | 6608 |
| 29 | Ga0068302_10257068 | 3300005071 | Bacteria | 1938 |
| 30 | Ga0466716_220577 | 3300042605 | Bacteria | 1481 |
| 31 | Ga0466719_158614 | 3300042606 | Bacteria | 13617 |
| 32 | Ga0466722_056019 | 3300042609 | Bacteria | 7648 |
| 33 | Ga0466722_179154 | 3300042609 | Bacteria | 5732 |
| 34 | Ga0466704_502987 | 3300042643 | Bacteria | 3153 |
| 35 | Ga0466709_418744 | 3300042648 | Bacteria | 33430 |
| 36 | Ga0466708_129025 | 3300042652 | Bacteria | 2726 |
| 37 | Ga0466708_247204 | 3300042652 | Bacteria | 3962 |
| 38 | Ga0466727_040229 | 3300042655 | Bacteria | 42184 |
| 39 | Ga0123353_10001771 | 3300010167 | Bacteria | 26500 |
| 40 | Ga0466696_211475 | 3300042596 | Bacteria | 24790 |
| 41 | Ga0466715_016941 | 3300042616 | Bacteria | 2017 |
| 42 | Ga0466723_110495 | 3300042618 | Bacteria | 37799 |
| 43 | Ga0466726_153274 | 3300042619 | Bacteria | 9457 |
| 44 | Ga0466726_371988 | 3300042619 | Bacteria | 3377 |
| 45 | Ga0466728_210940 | 3300042620 | Unclassified | 1733 |
| 46 | Ga0466728_458778 | 3300042620 | Bacteria | 6779 |
| 47 | JGI24698J34947_10094807 | 3300002449 | Bacteria | 1359 |
| 48 | JGI24705J35276_12235603 | 3300002504 | Bacteria | 6722 |
| 49 | Ga0068302_10252585 | 3300005071 | Bacteria | 2813 |
| 50 | Ga0466716_050747 | 3300042605 | Bacteria | 3114 |
| 51 | Ga0466716_264542 | 3300042605 | Bacteria | 4238 |
| 52 | Ga0466729_212534 | 3300042621 | Bacteria | 2536 |
| 53 | Ga0466704_168602 | 3300042643 | Bacteria | 2500 |
| 54 | Ga0466709_072865 | 3300042648 | Bacteria | 2945 |
| 55 | Ga0466708_130565 | 3300042652 | Bacteria | 5061 |
| 56 | Ga0466705_035023 | 3300042612 | Bacteria | 11255 |
| 57 | Ga0123353_11076866 | 3300010167 | Bacteria | 1070 |
| 58 | Ga0264413_138977 | 3300024493 | Unclassified | 5108 |
| 59 | Ga0466690_045264 | 3300042590 | Bacteria | 3234 |
| 60 | Ga0466690_214270 | 3300042590 | Bacteria | 1194 |
| 61 | Ga0466692_044295 | 3300042591 | Bacteria | 27264 |
| 62 | Ga0466691_153285 | 3300042593 | Bacteria | 8534 |
| 63 | Ga0466711_184269 | 3300042615 | Bacteria | 13134 |
| 64 | Ga0466715_018387 | 3300042616 | Unclassified | 4572 |
| 65 | Ga0466723_038825 | 3300042618 | Bacteria | 14509 |
| 66 | Ga0466728_125242 | 3300042620 | Bacteria | 3095 |
| 67 | IMNBL1DRAFT_c0002439 | 3300000062 | Bacteria | 12943 |
| 68 | Ga0466713_017933 | 3300042602 | Bacteria | 9255 |
| 69 | Ga0466719_353451 | 3300042606 | Bacteria | 5925 |
| 70 | Ga0466703_121476 | 3300042636 | Bacteria | 4568 |
| 71 | Ga0466704_362206 | 3300042643 | Bacteria | 17907 |
| 72 | Ga0466708_025157 | 3300042652 | Bacteria | 15972 |
| 73 | Ga0466708_095754 | 3300042652 | Bacteria | 2832 |
| 74 | Ga0466705_040205 | 3300042612 | Bacteria | 13238 |
| 75 | Ga0466690_227975 | 3300042590 | Bacteria | 7617 |
| 76 | Ga0466711_039341 | 3300042615 | Bacteria | 6951 |
| 77 | Ga0466715_142600 | 3300042616 | Bacteria | 6912 |
| 78 | Ga0466715_384156 | 3300042616 | Bacteria | 12865 |
| 79 | Ga0466715_427455 | 3300042616 | Bacteria | 20949 |
| 80 | Ga0466723_370516 | 3300042618 | Bacteria | 6896 |
| 81 | Ga0466728_473676 | 3300042620 | Bacteria | 1379 |
| 82 | JGI24702J35022_10039326 | 3300002462 | Bacteria | 2524 |
| 83 | JGI24696J40584_12958543 | 3300002834 | Bacteria | 4220 |
| 84 | Ga0466716_166157 | 3300042605 | Bacteria | 8588 |
| 85 | Ga0466719_178671 | 3300042606 | Bacteria | 1907 |
| 86 | Ga0466719_476030 | 3300042606 | Bacteria | 3505 |
| 87 | Ga0466722_219312 | 3300042609 | Bacteria | 3486 |
| 88 | Ga0466735_194091 | 3300042624 | Bacteria | 2431 |
| 89 | Ga0466703_028462 | 3300042636 | Bacteria | 9939 |
| 90 | Ga0466704_345396 | 3300042643 | Bacteria | 5067 |
| 91 | Ga0466704_378585 | 3300042643 | Bacteria | 15811 |
| 92 | Ga0466709_157485 | 3300042648 | Bacteria | 3163 |
| 93 | Ga0466725_013252 | 3300042654 | Bacteria | 1304 |
| 94 | Ga0466705_003668 | 3300042612 | Bacteria | 18332 |
| 95 | Ga0466705_022882 | 3300042612 | Unclassified | 5774 |
| 96 | Ga0466705_381272 | 3300042612 | Bacteria | 8231 |
| 97 | Ga0466690_017104 | 3300042590 | Bacteria | 4538 |
| 98 | Ga0466690_154025 | 3300042590 | Bacteria | 13948 |
| 99 | Ga0466696_092398 | 3300042596 | Bacteria | 31103 |
| 100 | Ga0466723_212200 | 3300042618 | Bacteria | 13278 |
| 101 | Ga0466723_234847 | 3300042618 | Bacteria | 21485 |
| 102 | Ga0466726_108489 | 3300042619 | Bacteria | 15292 |
| 103 | Ga0466728_358989 | 3300042620 | Bacteria | 1463 |
| 104 | Ga0072941_1292304 | 3300005201 | Bacteria | 9326 |
| 105 | Ga0466716_051923 | 3300042605 | Bacteria | 5900 |
| 106 | Ga0466716_137715 | 3300042605 | Bacteria | 5089 |
| 107 | Ga0466703_282481 | 3300042636 | Bacteria | 3999 |
| 108 | Ga0466704_182939 | 3300042643 | Bacteria | 26244 |
| 109 | Ga0466727_279126 | 3300042655 | Bacteria | 1657 |
| 110 | Ga0466690_042796 | 3300042590 | Bacteria | 1849 |
| 111 | Ga0466690_067936 | 3300042590 | Bacteria | 3860 |
| 112 | Ga0466691_139551 | 3300042593 | Bacteria | 6840 |
| 113 | Ga0466696_382463 | 3300042596 | Bacteria | 6021 |
| 114 | Ga0466711_147405 | 3300042615 | Bacteria | 3562 |
| 115 | Ga0466715_016833 | 3300042616 | Unclassified | 1868 |
| 116 | Ga0466723_180367 | 3300042618 | Bacteria | 8932 |
| 117 | Ga0466728_245329 | 3300042620 | Bacteria | 20586 |
| 118 | Ga0466728_273661 | 3300042620 | Bacteria | 3969 |
| 119 | Ga0072940_1132501 | 3300005200 | Bacteria | 2681 |
| 120 | Ga0466701_074418 | 3300042598 | Unclassified | 1142 |
| 121 | Ga0466719_386076 | 3300042606 | Bacteria | 1828 |
| 122 | Ga0466721_035223 | 3300042608 | Bacteria | 7980 |
| 123 | Ga0466703_026427 | 3300042636 | Bacteria | 3086 |
| 124 | Ga0466703_098340 | 3300042636 | Unclassified | 2403 |
| 125 | Ga0466704_270615 | 3300042643 | Bacteria | 12284 |
| 126 | Ga0466709_071215 | 3300042648 | Bacteria | 2925 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF00781 | GO:0016301 | kinase activity | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.