Protein Family IF06544
Metagenome
Isolate
230
Members
38
Samples
226
Scaffolds
248.07
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_281294|Ga0466719_281294_773_1630
- Length
- 285 aa
- Sequence
- MALKEEVNSSSCFLVGIIKILKHQPIIVKNMKNLTVLALLLLIIGNTSAVDTESYQFIDHLLSIPGPGAPEIYADTVIFTQPSTYRRVGIAFAHEGYARIYWFRKLLISEEEPVSSKGNSDAELPQATRVVHRDSGILFHVYTIPEGLGELRYRLIIDGLWTTDPGNSRISIDQKTGVSQSVVSLPLIQRDRPVFDPSGQPGGLSFTYTAPPGEQITVAGNFNNWDPFMYRLEEKSPGYYTLTLPLPPGTYHYVFFHRGQRLLDPANPFKAYTREGQAASEALVR
Sample Types
Isolate
1.7%
Metagenome
98.3%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
37.8%
Termitidae
32.4%
Unclassified
10.8%
Rhinotermitidae
8.1%
Termopsidae
8.1%
Blaberidae
2.7%
Taxonomy
Archaea
1
Bacteria
221
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042656 | Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a | Metagenome | Termitidae |
| 5 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 6 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 7 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 8 | 2781125653 | Treponema sp. Emb289P1bin107 | Isolate | Unclassified |
| 9 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 10 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 11 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 12 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 13 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 14 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 15 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 16 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 17 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 18 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 19 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 20 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 21 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 22 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 23 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 24 | 2772190975 | Treponema sp. RmG30 | Isolate | Blaberidae |
| 25 | 2781125691 | Treponema sp. Th196P3bin73 | Isolate | Unclassified |
| 26 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 27 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 28 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 29 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 2772190978 | Treponema sp. Nt197P3bin57 | Isolate | Unclassified |
| 37 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 38 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0264413_100102 | 3300024493 | Bacteria | 5114 |
| 2 | Ga0415639_043502 | 3300038395 | Bacteria | 2615 |
| 3 | Ga0415639_061810 | 3300038395 | Bacteria | 1271 |
| 4 | Ga0466690_209190 | 3300042590 | Bacteria | 5180 |
| 5 | Ga0466690_344628 | 3300042590 | Bacteria | 2843 |
| 6 | Ga0466692_032965 | 3300042591 | Bacteria | 2852 |
| 7 | Ga0466696_023880 | 3300042596 | Bacteria | 11842 |
| 8 | Ga0466696_195407 | 3300042596 | Bacteria | 5507 |
| 9 | Ga0466732_415175 | 3300042656 | Bacteria | 1232 |
| 10 | Ga0123356_10121745 | 3300010049 | Bacteria | 2539 |
| 11 | Ga0466729_240420 | 3300042621 | Bacteria | 1706 |
| 12 | Ga0466729_287051 | 3300042621 | Bacteria | 2164 |
| 13 | Ga0466735_116593 | 3300042624 | Bacteria | 4794 |
| 14 | Ga0466703_412509 | 3300042636 | Bacteria | 5661 |
| 15 | Ga0466704_564862 | 3300042643 | Bacteria | 6514 |
| 16 | Ga0466709_140924 | 3300042648 | Bacteria | 3328 |
| 17 | Ga0466709_330789 | 3300042648 | Bacteria | 6974 |
| 18 | Ga0466727_019389 | 3300042655 | Bacteria | 1790 |
| 19 | Ga0466700_279364 | 3300042600 | Bacteria | 1607 |
| 20 | Ga0466719_047140 | 3300042606 | Bacteria | 11442 |
| 21 | Ga0466719_075587 | 3300042606 | Bacteria | 3617 |
| 22 | Ga0466719_181674 | 3300042606 | Unclassified | 1116 |
| 23 | Ga0466705_257205 | 3300042612 | Bacteria | 1901 |
| 24 | Ga0466705_308271 | 3300042612 | Unclassified | 3369 |
| 25 | Ga0466711_013903 | 3300042615 | Bacteria | 8118 |
| 26 | Ga0466711_137202 | 3300042615 | Bacteria | 19315 |
| 27 | Ga0466711_169201 | 3300042615 | Bacteria | 10386 |
| 28 | Ga0466711_293849 | 3300042615 | Bacteria | 25662 |
| 29 | Ga0466715_291710 | 3300042616 | Bacteria | 15751 |
| 30 | Ga0466715_415309 | 3300042616 | Bacteria | 2671 |
| 31 | Ga0466723_079086 | 3300042618 | Bacteria | 3723 |
| 32 | Ga0466723_289308 | 3300042618 | Bacteria | 2141 |
| 33 | Ga0466723_351422 | 3300042618 | Bacteria | 7967 |
| 34 | Ga0466728_435240 | 3300042620 | Bacteria | 7219 |
| 35 | Ga0466692_097931 | 3300042591 | Bacteria | 9756 |
| 36 | Ga0466691_055198 | 3300042593 | Bacteria | 5063 |
| 37 | Ga0466696_243356 | 3300042596 | Bacteria | 15986 |
| 38 | Ga0466696_352950 | 3300042596 | Bacteria | 6765 |
| 39 | Ga0466696_433258 | 3300042596 | Bacteria | 1941 |
| 40 | Ga0466703_030518 | 3300042636 | Bacteria | 5729 |
| 41 | Ga0466703_265157 | 3300042636 | Bacteria | 10518 |
| 42 | Ga0466703_265742 | 3300042636 | Bacteria | 2691 |
| 43 | Ga0466704_036137 | 3300042643 | Bacteria | 8788 |
| 44 | Ga0466704_059447 | 3300042643 | Bacteria | 4885 |
| 45 | Ga0466709_184334 | 3300042648 | Bacteria | 4393 |
| 46 | Ga0466708_460735 | 3300042652 | Archaea | 6297 |
| 47 | Ga0466727_043204 | 3300042655 | Bacteria | 1545 |
| 48 | Ga0466719_030984 | 3300042606 | Bacteria | 8955 |
| 49 | Ga0466719_281294 | 3300042606 | Bacteria | 1910 |
| 50 | Ga0466722_001087 | 3300042609 | Bacteria | 12012 |
| 51 | Ga0466705_076926 | 3300042612 | Unclassified | 3140 |
| 52 | Ga0466705_201410 | 3300042612 | Bacteria | 10587 |
| 53 | Ga0466705_272944 | 3300042612 | Bacteria | 7051 |
| 54 | Ga0466705_442080 | 3300042612 | Bacteria | 1897 |
| 55 | Ga0466715_184194 | 3300042616 | Bacteria | 4134 |
| 56 | Ga0466723_005274 | 3300042618 | Bacteria | 3296 |
| 57 | Ga0466726_023515 | 3300042619 | Bacteria | 9081 |
| 58 | Ga0466726_051552 | 3300042619 | Bacteria | 1881 |
| 59 | Ga0466726_121611 | 3300042619 | Bacteria | 11809 |
| 60 | Ga0466726_352039 | 3300042619 | Bacteria | 1440 |
| 61 | Ga0466728_356528 | 3300042620 | Bacteria | 10229 |
| 62 | Ga0466729_037804 | 3300042621 | Bacteria | 1247 |
| 63 | Ga0466690_026707 | 3300042590 | Bacteria | 2870 |
| 64 | Ga0466690_319405 | 3300042590 | Bacteria | 2236 |
| 65 | Ga0466691_024535 | 3300042593 | Bacteria | 31111 |
| 66 | Ga0466691_091564 | 3300042593 | Bacteria | 6339 |
| 67 | JGI24702J35022_10014261 | 3300002462 | Bacteria | 4385 |
| 68 | Ga0466703_013897 | 3300042636 | Bacteria | 7838 |
| 69 | Ga0466703_103449 | 3300042636 | Unclassified | 2857 |
| 70 | Ga0466703_172155 | 3300042636 | Bacteria | 5914 |
| 71 | Ga0466704_183367 | 3300042643 | Bacteria | 7659 |
| 72 | Ga0466704_208264 | 3300042643 | Bacteria | 2763 |
| 73 | Ga0466709_252239 | 3300042648 | Bacteria | 8859 |
| 74 | Ga0466708_208839 | 3300042652 | Bacteria | 2117 |
| 75 | Ga0466708_256336 | 3300042652 | Bacteria | 3139 |
| 76 | Ga0466727_076808 | 3300042655 | Bacteria | 6263 |
| 77 | Ga0466707_422028 | 3300042601 | Bacteria | 1803 |
| 78 | Ga0466719_204380 | 3300042606 | Bacteria | 1268 |
| 79 | Ga0466720_018446 | 3300042607 | Bacteria | 2764 |
| 80 | Ga0466705_047059 | 3300042612 | Unclassified | 14729 |
| 81 | Ga0466711_206947 | 3300042615 | Bacteria | 2484 |
| 82 | Ga0466723_208272 | 3300042618 | Bacteria | 15129 |
| 83 | Ga0466726_368143 | 3300042619 | Bacteria | 6107 |
| 84 | Ga0466691_100642 | 3300042593 | Bacteria | 26233 |
| 85 | Ga0466691_119402 | 3300042593 | Bacteria | 3605 |
| 86 | Ga0466694_070661 | 3300042594 | Bacteria | 23704 |
| 87 | AustNasuHG_c1000154 | 3300000089 | Bacteria | 21784 |
| 88 | Ga0123355_10021364 | 3300009826 | Bacteria | 10357 |
| 89 | Ga0466703_258128 | 3300042636 | Bacteria | 6296 |
| 90 | Ga0466703_342161 | 3300042636 | Bacteria | 1341 |
| 91 | Ga0466703_389054 | 3300042636 | Bacteria | 16351 |
| 92 | Ga0466704_075647 | 3300042643 | Bacteria | 38985 |
| 93 | Ga0466704_087204 | 3300042643 | Bacteria | 41764 |
| 94 | Ga0466704_222363 | 3300042643 | Unclassified | 1544 |
| 95 | Ga0466704_599694 | 3300042643 | Bacteria | 14157 |
| 96 | Ga0466709_027397 | 3300042648 | Bacteria | 2345 |
| 97 | Ga0466708_064963 | 3300042652 | Bacteria | 6290 |
| 98 | Ga0466727_304218 | 3300042655 | Bacteria | 1498 |
| 99 | Ga0466707_357174 | 3300042601 | Bacteria | 1153 |
| 100 | Ga0466707_419676 | 3300042601 | Bacteria | 1108 |
| 101 | Ga0466716_372708 | 3300042605 | Bacteria | 18312 |
| 102 | Ga0466711_139109 | 3300042615 | Bacteria | 7550 |
| 103 | Ga0466715_362161 | 3300042616 | Bacteria | 2029 |
| 104 | Ga0466723_064261 | 3300042618 | Bacteria | 3693 |
| 105 | Ga0466723_279793 | 3300042618 | Bacteria | 5064 |
| 106 | Ga0466726_211471 | 3300042619 | Bacteria | 2142 |
| 107 | Ga0466726_366258 | 3300042619 | Bacteria | 1209 |
| 108 | Ga0466726_453041 | 3300042619 | Bacteria | 1323 |
| 109 | Ga0466728_003843 | 3300042620 | Bacteria | 2242 |
| 110 | Ga0466728_046030 | 3300042620 | Bacteria | 21134 |
| 111 | Ga0466728_104323 | 3300042620 | Bacteria | 5085 |
| 112 | Ga0466728_178374 | 3300042620 | Bacteria | 7010 |
| 113 | Ga0466690_087716 | 3300042590 | Unclassified | 1057 |
| 114 | Ga0466690_136662 | 3300042590 | Bacteria | 5996 |
| 115 | Ga0466690_314175 | 3300042590 | Bacteria | 14685 |
| 116 | Ga0466691_089496 | 3300042593 | Bacteria | 28725 |
| 117 | Ga0466691_202863 | 3300042593 | Bacteria | 5040 |
| 118 | Ga0466696_158836 | 3300042596 | Bacteria | 1609 |
| 119 | Ga0466696_470993 | 3300042596 | Bacteria | 8061 |
| 120 | Ga0466732_238302 | 3300042656 | Bacteria | 3043 |
| 121 | Ga0466732_374655 | 3300042656 | Bacteria | 9910 |
| 122 | Ga0123353_10038942 | 3300010167 | Bacteria | 7477 |
| 123 | Ga0466703_058581 | 3300042636 | Bacteria | 10592 |
| 124 | Ga0466704_297244 | 3300042643 | Bacteria | 3564 |
| 125 | Ga0466704_318573 | 3300042643 | Bacteria | 10038 |
| 126 | Ga0466708_209929 | 3300042652 | Bacteria | 22287 |
| 127 | Ga0466708_364541 | 3300042652 | Bacteria | 19474 |
| 128 | Ga0466727_094670 | 3300042655 | Bacteria | 1838 |
| 129 | Ga0466716_138509 | 3300042605 | Bacteria | 7691 |
| 130 | Ga0466716_216568 | 3300042605 | Bacteria | 6665 |
| 131 | Ga0466716_347156 | 3300042605 | Bacteria | 5351 |
| 132 | Ga0466719_009068 | 3300042606 | Bacteria | 2515 |
| 133 | Ga0466719_060566 | 3300042606 | Bacteria | 8463 |
| 134 | Ga0466719_178648 | 3300042606 | Bacteria | 5347 |
| 135 | Ga0466705_124535 | 3300042612 | Bacteria | 4717 |
| 136 | Ga0466705_284803 | 3300042612 | Bacteria | 4312 |
| 137 | Ga0466705_519806 | 3300042612 | Bacteria | 8145 |
| 138 | Ga0466705_531488 | 3300042612 | Bacteria | 1977 |
| 139 | Ga0466711_001111 | 3300042615 | Bacteria | 6318 |
| 140 | Ga0466711_239123 | 3300042615 | Bacteria | 43474 |
| 141 | Ga0466715_032230 | 3300042616 | Bacteria | 7106 |
| 142 | Ga0466718_164732 | 3300042617 | Bacteria | 1736 |
| 143 | Ga0466723_031819 | 3300042618 | Bacteria | 5069 |
| 144 | Ga0466723_326132 | 3300042618 | Bacteria | 4000 |
| 145 | Ga0466726_181837 | 3300042619 | Bacteria | 2061 |
| 146 | Ga0466726_476752 | 3300042619 | Bacteria | 3126 |
| 147 | Ga0466728_260729 | 3300042620 | Bacteria | 1610 |
| 148 | Ga0466729_069752 | 3300042621 | Bacteria | 2058 |
| 149 | Ga0415639_020097 | 3300038395 | Bacteria | 10036 |
| 150 | Ga0466690_029427 | 3300042590 | Bacteria | 7242 |
| 151 | Ga0466690_231381 | 3300042590 | Bacteria | 1208 |
| 152 | Ga0466691_020436 | 3300042593 | Bacteria | 15817 |
| 153 | Ga0466691_022218 | 3300042593 | Bacteria | 49548 |
| 154 | Ga0466691_085457 | 3300042593 | Bacteria | 12587 |
| 155 | Ga0466691_215980 | 3300042593 | Bacteria | 14042 |
| 156 | Ga0466696_082900 | 3300042596 | Bacteria | 49002 |
| 157 | Ga0466696_173561 | 3300042596 | Bacteria | 19308 |
| 158 | Ga0466696_315788 | 3300042596 | Bacteria | 1759 |
| 159 | Ga0466696_413211 | 3300042596 | Bacteria | 1680 |
| 160 | Ga0466727_349627 | 3300042655 | Bacteria | 1586 |
| 161 | Ga0123353_10779042 | 3300010167 | Bacteria | 1325 |
| 162 | Ga0466703_160483 | 3300042636 | Bacteria | 11827 |
| 163 | Ga0466703_174259 | 3300042636 | Bacteria | 3437 |
| 164 | Ga0466703_177172 | 3300042636 | Bacteria | 2877 |
| 165 | Ga0466703_182689 | 3300042636 | Bacteria | 9535 |
| 166 | Ga0466704_190771 | 3300042643 | Bacteria | 2083 |
| 167 | Ga0466709_268561 | 3300042648 | Bacteria | 3508 |
| 168 | Ga0466709_357342 | 3300042648 | Bacteria | 30075 |
| 169 | Ga0466708_126041 | 3300042652 | Bacteria | 12309 |
| 170 | Ga0466727_019145 | 3300042655 | Bacteria | 3353 |
| 171 | Ga0466707_338804 | 3300042601 | Bacteria | 1777 |
| 172 | Ga0466719_011324 | 3300042606 | Bacteria | 8580 |
| 173 | Ga0466719_375606 | 3300042606 | Bacteria | 1763 |
| 174 | Ga0466711_069975 | 3300042615 | Bacteria | 7411 |
| 175 | Ga0466711_498086 | 3300042615 | Bacteria | 1277 |
| 176 | Ga0466715_126402 | 3300042616 | Bacteria | 5502 |
| 177 | Ga0466723_211395 | 3300042618 | Bacteria | 18359 |
| 178 | Ga0466723_221716 | 3300042618 | Bacteria | 48106 |
| 179 | Ga0466728_194579 | 3300042620 | Bacteria | 4242 |
| 180 | Ga0466728_254002 | 3300042620 | Bacteria | 5136 |
| 181 | Ga0466728_339254 | 3300042620 | Bacteria | 1863 |
| 182 | Ga0264413_109585 | 3300024493 | Bacteria | 12419 |
| 183 | Ga0466690_263016 | 3300042590 | Bacteria | 35434 |
| 184 | Ga0466690_309432 | 3300042590 | Bacteria | 1082 |
| 185 | Ga0466690_369109 | 3300042590 | Bacteria | 2588 |
| 186 | Ga0466691_137120 | 3300042593 | Bacteria | 4813 |
| 187 | Ga0466696_135373 | 3300042596 | Bacteria | 2029 |
| 188 | JGI24695J34938_10000579 | 3300002450 | Bacteria | 35323 |
| 189 | Ga0466703_104835 | 3300042636 | Bacteria | 1876 |
| 190 | Ga0466703_269866 | 3300042636 | Bacteria | 10754 |
| 191 | Ga0466704_014739 | 3300042643 | Bacteria | 7072 |
| 192 | Ga0466704_309573 | 3300042643 | Bacteria | 2701 |
| 193 | Ga0466708_041676 | 3300042652 | Bacteria | 1251 |
| 194 | Ga0466708_066871 | 3300042652 | Bacteria | 12462 |
| 195 | Ga0466708_081635 | 3300042652 | Bacteria | 63753 |
| 196 | Ga0466727_025887 | 3300042655 | Bacteria | 2087 |
| 197 | Ga0466707_120572 | 3300042601 | Bacteria | 1308 |
| 198 | Ga0466716_274609 | 3300042605 | Bacteria | 12487 |
| 199 | Ga0466719_089929 | 3300042606 | Bacteria | 1542 |
| 200 | Ga0466719_107925 | 3300042606 | Bacteria | 71556 |
| 201 | Ga0466719_184016 | 3300042606 | Bacteria | 11302 |
| 202 | Ga0466715_152041 | 3300042616 | Bacteria | 4300 |
| 203 | Ga0466723_091625 | 3300042618 | Bacteria | 45311 |
| 204 | Ga0466723_176248 | 3300042618 | Bacteria | 41588 |
| 205 | Ga0466726_210108 | 3300042619 | Bacteria | 1268 |
| 206 | Ga0466728_194108 | 3300042620 | Bacteria | 9474 |
| 207 | Ga0466729_020766 | 3300042621 | Bacteria | 3406 |
| 208 | Ga0466691_027913 | 3300042593 | Bacteria | 52900 |
| 209 | Ga0466691_094723 | 3300042593 | Bacteria | 5900 |
| 210 | Ga0466694_078242 | 3300042594 | Bacteria | 4535 |
| 211 | Ga0466732_138820 | 3300042656 | Bacteria | 5594 |
| 212 | Ga0466732_452466 | 3300042656 | Bacteria | 3658 |
| 213 | Ga0466703_274969 | 3300042636 | Bacteria | 11427 |
| 214 | Ga0466704_299506 | 3300042643 | Unclassified | 14693 |
| 215 | Ga0466704_342013 | 3300042643 | Bacteria | 10900 |
| 216 | Ga0466709_085316 | 3300042648 | Bacteria | 40552 |
| 217 | Ga0466709_226910 | 3300042648 | Bacteria | 36038 |
| 218 | Ga0466709_349692 | 3300042648 | Bacteria | 2014 |
| 219 | Ga0466708_013957 | 3300042652 | Bacteria | 1801 |
| 220 | Ga0466708_406819 | 3300042652 | Bacteria | 5292 |
| 221 | Ga0466705_050473 | 3300042612 | Bacteria | 6429 |
| 222 | Ga0466705_354537 | 3300042612 | Bacteria | 1324 |
| 223 | Ga0466715_263544 | 3300042616 | Bacteria | 2710 |
| 224 | Ga0466715_479667 | 3300042616 | Bacteria | 3246 |
| 225 | Ga0466726_016663 | 3300042619 | Bacteria | 8548 |
| 226 | Ga0466726_105183 | 3300042619 | Bacteria | 7160 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.