Protein Family IF06514
Metagenome
Isolate
126
Members
33
Samples
116
Scaffolds
249.75
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_197898|Ga0466719_197898_427_1371
- Length
- 295 aa
- Sequence
- LTEAPQGQAWALSDVLPRLFFHSNLELPGESLFSFLPEAMIQFMRWFSGLNGTLQALLACLFTYGVTALGSAMVFFFKSINRKVLDGMLGFAGGVMIAASFFSLLAPAITMAEVVHESGRGLPAWAAAVIGFILGGAFLRLADTLLPHLHVGMKSAEGIKTNWGRSALLVLAITLHNIPEGLAVGVGFGAASTIPGASLAGALPLRREGMSRLRSFWIGQASGIVEPIAGVLGAALVMSMQAVLPYALSFAAGAMIFVVAEELIPEAYAEGNDHIATSGIVLGFALMMALDVGLG
Sample Types
Isolate
7.9%
Metagenome
92.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
42.4%
Culicidae
24.2%
Unclassified
12.1%
Termopsidae
9.1%
Rhinotermitidae
6.1%
Termitidae
3.0%
Hodotermitidae
3.0%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
11
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 2 | 8063589291 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 3 | 8063597228 | Entomospira culicis BR151 | Isolate | Culicidae |
| 4 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 5 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 6 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 7 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 8 | 2964144231 | Entomospira culicis BR151 | Isolate | Culicidae |
| 9 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 10 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 11 | 2964266314 | Entomospira nematocera BR208 | Isolate | Culicidae |
| 12 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 13 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 14 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 15 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 16 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 17 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 18 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 2964130733 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 21 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 22 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 23 | 8063595521 | Entomospira culicis BR149 | Isolate | Culicidae |
| 24 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 25 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 26 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 27 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 28 | 2964145936 | Entomospira culicis BR149 | Isolate | Culicidae |
| 29 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 30 | 8063587521 | Entomospira entomophilus BR193 | Isolate | Culicidae |
| 31 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 32 | 3300042599 | Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 | Metagenome | Hodotermitidae |
| 33 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_083070 | 3300042612 | Bacteria | 39024 |
| 2 | Ga0466705_142428 | 3300042612 | Unclassified | 6397 |
| 3 | Ga0466705_199747 | 3300042612 | Bacteria | 2879 |
| 4 | Ga0466705_412095 | 3300042612 | Bacteria | 7608 |
| 5 | Ga0466711_085756 | 3300042615 | Bacteria | 33515 |
| 6 | Ga0466711_226810 | 3300042615 | Bacteria | 3037 |
| 7 | Ga0466715_004485 | 3300042616 | Bacteria | 24028 |
| 8 | Ga0466715_064769 | 3300042616 | Bacteria | 19592 |
| 9 | Ga0466715_439070 | 3300042616 | Bacteria | 5379 |
| 10 | Ga0466723_044402 | 3300042618 | Bacteria | 11711 |
| 11 | Ga0466728_168063 | 3300042620 | Bacteria | 2634 |
| 12 | Ga0466706_211051 | 3300042599 | Bacteria | 2510 |
| 13 | Ga0466713_070599 | 3300042602 | Bacteria | 4419 |
| 14 | Ga0466719_030407 | 3300042606 | Bacteria | 6575 |
| 15 | Ga0466719_091732 | 3300042606 | Bacteria | 18239 |
| 16 | Ga0466735_095327 | 3300042624 | Bacteria | 3550 |
| 17 | Ga0466703_212383 | 3300042636 | Bacteria | 15812 |
| 18 | Ga0466703_331607 | 3300042636 | Bacteria | 15314 |
| 19 | Ga0466704_146920 | 3300042643 | Bacteria | 28455 |
| 20 | Ga0466709_197497 | 3300042648 | Bacteria | 5303 |
| 21 | Ga0466708_047304 | 3300042652 | Bacteria | 2703 |
| 22 | Ga0466727_211195 | 3300042655 | Bacteria | 1934 |
| 23 | Ga0466691_080851 | 3300042593 | Bacteria | 5272 |
| 24 | Ga0466691_179701 | 3300042593 | Bacteria | 6417 |
| 25 | Ga0466705_204513 | 3300042612 | Bacteria | 8817 |
| 26 | Ga0466733_205711 | 3300042659 | Bacteria | 1234 |
| 27 | Ga0466711_014343 | 3300042615 | Bacteria | 4453 |
| 28 | Ga0466715_476209 | 3300042616 | Bacteria | 12373 |
| 29 | Ga0466723_088841 | 3300042618 | Bacteria | 2752 |
| 30 | Ga0466726_369754 | 3300042619 | Bacteria | 2216 |
| 31 | Ga0466713_123048 | 3300042602 | Bacteria | 1388 |
| 32 | Ga0466719_445654 | 3300042606 | Unclassified | 1840 |
| 33 | Ga0466704_288260 | 3300042643 | Bacteria | 16251 |
| 34 | Ga0466709_035229 | 3300042648 | Bacteria | 2099 |
| 35 | Ga0466727_187717 | 3300042655 | Bacteria | 2386 |
| 36 | Ga0466727_266391 | 3300042655 | Bacteria | 17904 |
| 37 | Ga0466692_149528 | 3300042591 | Bacteria | 25005 |
| 38 | Ga0466696_165650 | 3300042596 | Bacteria | 8560 |
| 39 | Ga0466705_008883 | 3300042612 | Bacteria | 10527 |
| 40 | Ga0466705_026607 | 3300042612 | Bacteria | 47022 |
| 41 | Ga0466733_040471 | 3300042659 | Bacteria | 4916 |
| 42 | Ga0466711_169796 | 3300042615 | Bacteria | 7812 |
| 43 | Ga0466723_340850 | 3300042618 | Bacteria | 7615 |
| 44 | Ga0466728_139263 | 3300042620 | Bacteria | 1881 |
| 45 | Ga0466719_171428 | 3300042606 | Bacteria | 2383 |
| 46 | Ga0466719_197898 | 3300042606 | Bacteria | 1995 |
| 47 | Ga0466719_277720 | 3300042606 | Unclassified | 1445 |
| 48 | Ga0466703_091206 | 3300042636 | Bacteria | 37744 |
| 49 | Ga0466709_221410 | 3300042648 | Unclassified | 1119 |
| 50 | Ga0466727_298750 | 3300042655 | Bacteria | 1239 |
| 51 | Ga0466691_013075 | 3300042593 | Bacteria | 2924 |
| 52 | Ga0466705_244568 | 3300042612 | Bacteria | 5562 |
| 53 | Ga0466705_352334 | 3300042612 | Bacteria | 6614 |
| 54 | Ga0466733_188288 | 3300042659 | Bacteria | 1396 |
| 55 | Ga0466733_189248 | 3300042659 | Bacteria | 27547 |
| 56 | Ga0466723_094839 | 3300042618 | Bacteria | 11689 |
| 57 | Ga0466726_015009 | 3300042619 | Bacteria | 1851 |
| 58 | Ga0466704_005795 | 3300042643 | Unclassified | 5457 |
| 59 | Ga0466704_198458 | 3300042643 | Bacteria | 5129 |
| 60 | Ga0466709_320867 | 3300042648 | Bacteria | 6336 |
| 61 | Ga0466727_095687 | 3300042655 | Bacteria | 8107 |
| 62 | Ga0466696_059871 | 3300042596 | Bacteria | 12619 |
| 63 | Ga0466705_313708 | 3300042612 | Bacteria | 7883 |
| 64 | Ga0466705_404810 | 3300042612 | Bacteria | 1652 |
| 65 | Ga0466711_165478 | 3300042615 | Bacteria | 2161 |
| 66 | Ga0466715_646411 | 3300042616 | Bacteria | 11155 |
| 67 | Ga0466726_460980 | 3300042619 | Unclassified | 1162 |
| 68 | Ga0466728_076390 | 3300042620 | Bacteria | 3412 |
| 69 | Ga0466735_033595 | 3300042624 | Unclassified | 1605 |
| 70 | Ga0466703_007150 | 3300042636 | Bacteria | 7926 |
| 71 | Ga0466704_170173 | 3300042643 | Bacteria | 13167 |
| 72 | Ga0466704_441677 | 3300042643 | Unclassified | 6648 |
| 73 | Ga0466709_107674 | 3300042648 | Bacteria | 3387 |
| 74 | Ga0466727_108477 | 3300042655 | Unclassified | 2906 |
| 75 | Ga0466696_333914 | 3300042596 | Bacteria | 5694 |
| 76 | Ga0466705_318531 | 3300042612 | Bacteria | 1692 |
| 77 | Ga0466733_012376 | 3300042659 | Bacteria | 51013 |
| 78 | Ga0466711_086068 | 3300042615 | Bacteria | 9631 |
| 79 | Ga0466715_246166 | 3300042616 | Unclassified | 5304 |
| 80 | Ga0466715_353120 | 3300042616 | Bacteria | 2910 |
| 81 | Ga0466715_427158 | 3300042616 | Bacteria | 13811 |
| 82 | Ga0466723_042467 | 3300042618 | Bacteria | 7608 |
| 83 | Ga0466726_164196 | 3300042619 | Bacteria | 13549 |
| 84 | Ga0466726_261034 | 3300042619 | Bacteria | 2700 |
| 85 | Ga0466704_068054 | 3300042643 | Bacteria | 10568 |
| 86 | Ga0466704_368337 | 3300042643 | Bacteria | 25914 |
| 87 | Ga0466704_421051 | 3300042643 | Bacteria | 2554 |
| 88 | Ga0466690_236173 | 3300042590 | Bacteria | 2651 |
| 89 | Ga0466692_116451 | 3300042591 | Bacteria | 68874 |
| 90 | Ga0466705_151298 | 3300042612 | Bacteria | 3407 |
| 91 | Ga0466705_312245 | 3300042612 | Bacteria | 4771 |
| 92 | Ga0466705_409646 | 3300042612 | Bacteria | 11567 |
| 93 | Ga0466711_047179 | 3300042615 | Bacteria | 21134 |
| 94 | Ga0466715_024137 | 3300042616 | Unclassified | 3120 |
| 95 | Ga0466715_306652 | 3300042616 | Bacteria | 11984 |
| 96 | Ga0466726_048963 | 3300042619 | Bacteria | 2961 |
| 97 | Ga0466726_284016 | 3300042619 | Bacteria | 1595 |
| 98 | Ga0466728_292926 | 3300042620 | Bacteria | 3497 |
| 99 | Ga0466728_434424 | 3300042620 | Bacteria | 2584 |
| 100 | Ga0466707_073489 | 3300042601 | Bacteria | 1390 |
| 101 | Ga0466713_076140 | 3300042602 | Bacteria | 1614 |
| 102 | Ga0466719_282182 | 3300042606 | Bacteria | 5143 |
| 103 | Ga0466703_105104 | 3300042636 | Bacteria | 5995 |
| 104 | Ga0466704_173997 | 3300042643 | Bacteria | 7270 |
| 105 | Ga0466708_104645 | 3300042652 | Bacteria | 9725 |
| 106 | Ga0466692_028408 | 3300042591 | Bacteria | 1997 |
| 107 | Ga0466692_167727 | 3300042591 | Bacteria | 5007 |
| 108 | Ga0466696_114477 | 3300042596 | Bacteria | 20348 |
| 109 | Ga0466726_070152 | 3300042619 | Bacteria | 1786 |
| 110 | Ga0466716_015282 | 3300042605 | Bacteria | 25597 |
| 111 | Ga0466719_004965 | 3300042606 | Bacteria | 1667 |
| 112 | Ga0466722_021724 | 3300042609 | Bacteria | 2511 |
| 113 | Ga0466704_202786 | 3300042643 | Bacteria | 17396 |
| 114 | Ga0466690_375064 | 3300042590 | Bacteria | 3250 |
| 115 | Ga0466692_029373 | 3300042591 | Bacteria | 8369 |
| 116 | Ga0466691_055340 | 3300042593 | Bacteria | 2160 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF02535 | Zip | ZIP Zinc transporter | 165 | 290 | 0.87 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.