Protein Family IF06509

Metagenome Isolate
120 Members
27 Samples
117 Scaffolds
389.55 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_186346|Ga0466719_186346_16385_17668
Length
427 aa
Sequence
MAYFYSFSYCKPNRRLGSAGCGQARSRKAFHHEEEKMNKTCIFTGIFSLLVLSSLMAGAGKEQTGASIKIGFNIPLTGDSPKVGEGAKYAAELIRQGIHAAGGLEVKGKKYPVEFIYVDNELKAESAIQAAYKLIEQDKVLAVVGPCGSGRAIPAGQVNNESRTPMISPWATNPDVTRNRPYVFRACILDPVQAPAAVQFAKSQFNVSKTAILYNLDDDYSKTLAELFRDNWEKTNGPGSVVAFESFGQKDQDFSVQLTRILNTGAQLLYLPDYYNHVALIVPQAKDLGWGDKPVLGSDSWGSADLVNLSKGSVKGYYFTTHYAAAGAVGATKTFIDEYQAAYGYVPDDVAALSYDSIRIILQAIQSSGLTGDIQKDREAIKNAIAGMKDFEGITGKMTFDANGDPAKKAVVVKISDSGEFEYVTSL

📊 Sample Types

Isolate 1.7%
Metagenome 98.3%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Kalotermitidae 51.9%
Unclassified 18.5%
Termopsidae 11.1%
Rhinotermitidae 7.4%
Termitidae 7.4%
Hodotermitidae 3.7%

🌳 Taxonomy

Archaea 0
Bacteria 109
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
2 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
3 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
4 3300042599 Termite gut microbial communities of Hodotermes mossambicus from Pretoria, South Africa - Hm464 Metagenome Hodotermitidae
5 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
6 3300042618 Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 Metagenome Kalotermitidae
7 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
8 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
9 3300005083 Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial Metagenome Unclassified
10 3300042601 Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 Metagenome Unclassified
11 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
12 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
13 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
14 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
15 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
16 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
17 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
18 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
19 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
20 650716099 Leadbettera azotonutricia ZAS-9 Isolate Unclassified
21 650716102 Treponema primitia ZAS-2 Isolate Unclassified
22 3300042624 Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 Metagenome Termopsidae
23 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
24 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
25 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
26 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
27 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466690_188609 3300042590 Bacteria 9284
2 Ga0466691_225641 3300042593 Bacteria 6049
3 Ga0466706_041611 3300042599 Bacteria 3315
4 Ga0466707_145961 3300042601 Bacteria 5367
5 Ga0068305_10785239 3300005083 Bacteria 1695
6 Ga0466711_014227 3300042615 Bacteria 2556
7 Ga0466711_072915 3300042615 Bacteria 2040
8 Ga0466723_110610 3300042618 Unclassified 5641
9 Ga0466726_196499 3300042619 Bacteria 6278
10 Ga0466728_021247 3300042620 Unclassified 15055
11 Ga0466728_099772 3300042620 Bacteria 15289
12 Ga0466728_286666 3300042620 Bacteria 8536
13 Ga0466703_010650 3300042636 Bacteria 6706
14 Ga0466703_111628 3300042636 Bacteria 11536
15 Ga0466709_024100 3300042648 Unclassified 1914
16 Ga0466708_005306 3300042652 Bacteria 20730
17 Ga0466691_038295 3300042593 Bacteria 2548
18 Ga0466691_078260 3300042593 Bacteria 30283
19 Ga0466699_256618 3300042597 Bacteria 1702
20 Ga0466707_176623 3300042601 Bacteria 2888
21 Ga0466707_265599 3300042601 Bacteria 2167
22 Ga0466716_203215 3300042605 Bacteria 5800
23 Ga0068305_10012601 3300005083 Bacteria 4367
24 Ga0466712_312163 3300042614 Bacteria 5231
25 Ga0466715_263882 3300042616 Bacteria 2736
26 Ga0466715_388435 3300042616 Bacteria 2389
27 Ga0466723_203526 3300042618 Bacteria 10666
28 Ga0466728_077724 3300042620 Bacteria 1452
29 Ga0466704_546323 3300042643 Bacteria 22587
30 Ga0466709_126320 3300042648 Bacteria 20237
31 Ga0466727_139194 3300042655 Bacteria 19736
32 Ga0466727_160042 3300042655 Bacteria 2438
33 Ga0466705_015914 3300042612 Bacteria 9654
34 Ga0466705_171968 3300042612 Bacteria 6846
35 Ga0466716_088539 3300042605 Unclassified 2908
36 Ga0466722_155557 3300042609 Bacteria 13173
37 Ga0466711_123327 3300042615 Bacteria 2400
38 Ga0466715_554763 3300042616 Bacteria 6888
39 Ga0466703_062952 3300042636 Bacteria 6397
40 Ga0466708_064572 3300042652 Bacteria 68987
41 Ga0466708_109932 3300042652 Bacteria 8561
42 Ga0466708_199558 3300042652 Bacteria 5067
43 Ga0466708_304531 3300042652 Bacteria 3562
44 Ga0466708_466114 3300042652 Unclassified 1551
45 Ga0466690_000984 3300042590 Bacteria 53852
46 Ga0466690_033619 3300042590 Unclassified 5492
47 Ga0466691_169725 3300042593 Bacteria 19309
48 Ga0466707_311146 3300042601 Bacteria 1782
49 Ga0466713_109217 3300042602 Bacteria 3129
50 Ga0466713_109373 3300042602 Bacteria 26912
51 Ga0466716_140477 3300042605 Bacteria 11909
52 Ga0466716_370517 3300042605 Bacteria 5059
53 Ga0466716_528757 3300042605 Bacteria 2859
54 Ga0466711_196633 3300042615 Bacteria 8623
55 Ga0466711_268220 3300042615 Bacteria 8761
56 Ga0466715_239060 3300042616 Bacteria 4411
57 Ga0466715_261680 3300042616 Bacteria 3005
58 Ga0466723_099650 3300042618 Bacteria 10311
59 Ga0466735_199276 3300042624 Bacteria 1718
60 Ga0466703_047397 3300042636 Bacteria 4899
61 Ga0466692_014696 3300042591 Bacteria 13936
62 Ga0466706_027384 3300042599 Bacteria 1442
63 Ga0466706_219951 3300042599 Bacteria 7756
64 Ga0466716_171013 3300042605 Bacteria 3466
65 Ga0466716_324900 3300042605 Bacteria 7467
66 Ga0466719_124460 3300042606 Unclassified 7588
67 Ga0466705_406475 3300042612 Bacteria 5552
68 Ga0466711_053127 3300042615 Bacteria 43418
69 Ga0466711_128328 3300042615 Bacteria 10167
70 Ga0466723_004315 3300042618 Bacteria 2326
71 Ga0466723_016280 3300042618 Bacteria 23329
72 Ga0466723_121143 3300042618 Bacteria 3522
73 Ga0466735_172248 3300042624 Bacteria 4143
74 Ga0466707_013414 3300042601 Bacteria 28403
75 Ga0466713_082097 3300042602 Bacteria 15536
76 Ga0466723_055006 3300042618 Bacteria 6194
77 Ga0466728_070067 3300042620 Bacteria 5034
78 Ga0466703_118266 3300042636 Bacteria 39271
79 Ga0466709_085316 3300042648 Bacteria 40552
80 Ga0466709_151353 3300042648 Unclassified 8034
81 Ga0466708_378180 3300042652 Bacteria 4038
82 Ga0466727_016501 3300042655 Bacteria 2438
83 Ga0466705_014697 3300042612 Bacteria 9049
84 Ga0466690_208441 3300042590 Bacteria 17129
85 Ga0466690_382928 3300042590 Bacteria 2497
86 Ga0466691_008048 3300042593 Bacteria 7644
87 Ga0466691_013952 3300042593 Bacteria 6190
88 Ga0466691_059987 3300042593 Unclassified 2890
89 Ga0466699_216632 3300042597 Bacteria 4523
90 Ga0466707_195928 3300042601 Bacteria 2342
91 Ga0466713_141182 3300042602 Bacteria 10484
92 Ga0466716_140875 3300042605 Bacteria 21912
93 Ga0466735_038633 3300042624 Bacteria 3040
94 Ga0466704_156708 3300042643 Bacteria 46271
95 Ga0466709_330168 3300042648 Bacteria 12240
96 Ga0466708_034362 3300042652 Bacteria 4373
97 Ga0466708_351532 3300042652 Bacteria 7534
98 Ga0466727_296393 3300042655 Bacteria 1842
99 Ga0466690_020801 3300042590 Bacteria 1645
100 Ga0466690_123507 3300042590 Bacteria 4471
101 Ga0466690_151515 3300042590 Bacteria 20912
102 Ga0466691_008810 3300042593 Bacteria 9363
103 Ga0466691_160155 3300042593 Bacteria 11901
104 Ga0466696_184375 3300042596 Bacteria 12596
105 Ga0466707_260896 3300042601 Bacteria 1343
106 Ga0466716_169560 3300042605 Unclassified 2720
107 Ga0466719_186346 3300042606 Bacteria 17976
108 Ga0466719_460780 3300042606 Bacteria 37540
109 Ga0068305_10006596 3300005083 Bacteria 7893
110 Ga0466711_155815 3300042615 Bacteria 2098
111 Ga0466711_266704 3300042615 Bacteria 12558
112 Ga0466715_073782 3300042616 Bacteria 23076
113 Ga0466723_057377 3300042618 Bacteria 13108
114 Ga0466735_083883 3300042624 Bacteria 3700
115 Ga0466735_127747 3300042624 Bacteria 2853
116 Ga0466704_439686 3300042643 Bacteria 95559
117 Ga0466708_090934 3300042652 Unclassified 6632

🧩 MSA Aligner

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF13458 Peripla_BP_6 Periplasmic binding protein 67 419 0.93
PF01094 ANF_receptor Receptor family ligand binding region 111 414 0.83
PF13433 Peripla_BP_5 Periplasmic binding protein domain 197 425 0.76

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.