Protein Family IF06493

Metagenome Isolate
155 Members
48 Samples
152 Scaffolds
130.41 Avg Length

🧬 Representative Sequence

ID
3300042606|Ga0466719_149218|Ga0466719_149218_1763_2212
Length
149 aa
Sequence
MERYESWIDRAKSSYELSKANINTIIYFEDLCYQVQQAVEKSLKGLLIYFGDEPEFTHNIGVLLNEIEKHIEIPDDVKNAIDLTNYAVQTRYPGEYDEITKEEYENSLRIAKNCLDWSGLKAPRPPQWLGHSAPQHSWGTLYSHFDIAA

📊 Sample Types

Isolate 1.9%
Metagenome 98.1%
MAG 0.0%
Metatranscriptome 0.0%
Single Cell 0.0%

🐛 Taxa Family Distribution

Termitidae 53.2%
Kalotermitidae 27.7%
Unclassified 8.5%
Termopsidae 6.4%
Rhinotermitidae 4.3%

🌳 Taxonomy

Archaea 5
Bacteria 139
Eukaryota 0
Viruses 0
Unclassified 11

🗂️ Samples

#Sample IDDescriptionTypeTaxa Family
1 2781125652 Treponema sp. Cu122P5bin1 Isolate Unclassified
2 3300042622 Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 Metagenome Termitidae
3 3300042635 Termite gut microbial communities of Globitermes sulphureus from Bubeng, China - Glo450 Metagenome Termitidae
4 3300042643 Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 Metagenome Kalotermitidae
5 3300042648 Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 Metagenome Kalotermitidae
6 3300042656 Termite gut microbial communities of Trinervitermes sp. from JKUAT Farm, Juja, Kenya - TD114a Metagenome Termitidae
7 3300002507 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P1 Metagenome Termitidae
8 3300005071 Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 Metagenome Termopsidae
9 3300042596 Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 Metagenome Kalotermitidae
10 3300042605 Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 Metagenome Kalotermitidae
11 3300042616 Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 Metagenome Kalotermitidae
12 3300000089 Insect hindgut associated microbial communities from Australia - Nasutitermes Metagenome Termitidae
13 3300002508 Microcerotermes parvus P1 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P1 Metagenome Termitidae
14 3300005200 Nasutitermes gut metagenome Metagenome Termitidae
15 3300042609 Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 Metagenome Rhinotermitidae
16 3300042620 Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 Metagenome Kalotermitidae
17 3300042655 Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 Metagenome Termopsidae
18 3300002504 Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 Metagenome Termitidae
19 3300024493 Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics Metagenome
20 3300042590 Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 Metagenome Kalotermitidae
21 3300042593 Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 Metagenome Kalotermitidae
22 3300042606 Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 Metagenome Kalotermitidae
23 3300042619 Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 Metagenome Termopsidae
24 3300042652 Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 Metagenome Kalotermitidae
25 3300002450 Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 Metagenome Termitidae
26 3300010049 Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 Metagenome Termitidae
27 3300010167 Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 Metagenome Termitidae
28 3300042591 Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 Metagenome Rhinotermitidae
29 3300042597 Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 Metagenome Termitidae
30 3300042614 Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 Metagenome Termitidae
31 3300042636 Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 Metagenome Kalotermitidae
32 3300002449 Microcerotermes parvus P3 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193 P3 Metagenome Termitidae
33 3300042598 Termite gut microbial communities of Furculitermes sp. from Ebogo II, Mbalmayo, Cameroon - Fux382 Metagenome Termitidae
34 3300042604 Termite gut microbial communities of Neocapritermes taracua from Petit Saut, French Guiana, France - Nct323 Metagenome Termitidae
35 3300042610 Termite gut microbial communities of Constrictotermes cavifrons from Petit Saut, French Guiana, France - Cx337 Metagenome Termitidae
36 3300042611 Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 Metagenome Termitidae
37 3300042615 Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 Metagenome Kalotermitidae
38 3300002509 Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 Metagenome Termitidae
39 3300042594 Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 Metagenome Termitidae
40 3300042600 Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 Metagenome Termitidae
41 3300042602 Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 Metagenome Unclassified
42 3300042608 Termite gut microbial communities of Palmitermes impostor from Petit Saut, French Guiana, France - Pal332 Metagenome Termitidae
43 3300042612 Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 Metagenome Kalotermitidae
44 3300042617 Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 Metagenome Termitidae
45 2781125689 Treponema sp. Mp193P4bin9 Isolate Unclassified
46 2819994798 Unclassified Spirochaetes Th196P1bin3 Isolate Unclassified
47 3300042623 Termite gut microbial communities of Dicuspiditermes spinitibialis from Bubeng, China - Xx448 Metagenome Termitidae
48 3300009826 Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 Metagenome Termitidae

🔗 Scaffolds

#ScaffoldSampleTaxonomyLength
1 Ga0466721_011515 3300042608 Bacteria 1124
2 Ga0466698_452728 3300042610 Bacteria 1507
3 Ga0264413_101478 3300024493 Bacteria 3127
4 Ga0264413_112777 3300024493 Unclassified 4645
5 Ga0123356_11338634 3300010049 Bacteria 878
6 Ga0123353_12873311 3300010167 Bacteria 562
7 Ga0466731_226223 3300042622 Bacteria 1015
8 JGI24698J34947_10171785 3300002449 Bacteria 876
9 JGI24698J34947_10304085 3300002449 Bacteria 574
10 JGI24695J34938_10094968 3300002450 Bacteria 1221
11 Ga0068302_10315147 3300005071 Bacteria 500
12 Ga0466712_181014 3300042614 Bacteria 1170
13 Ga0466712_264621 3300042614 Bacteria 1915
14 Ga0466711_120956 3300042615 Bacteria 1189
15 Ga0466691_050389 3300042593 Unclassified 3096
16 Ga0466694_257216 3300042594 Bacteria 1007
17 Ga0466696_117648 3300042596 Bacteria 9509
18 Ga0123356_10585469 3300010049 Bacteria 1279
19 Ga0466727_085982 3300042655 Bacteria 1267
20 JGI24698J34947_10031575 3300002449 Bacteria 2787
21 JGI24698J34947_10142761 3300002449 Bacteria 1006
22 JGI24695J34938_10056908 3300002450 Archaea 1683
23 JGI24695J34938_10162966 3300002450 Bacteria 917
24 JGI24695J34938_10204058 3300002450 Unclassified 825
25 JGI24699J35502_10941383 3300002509 Bacteria 1146
26 JGI24699J35502_11133860 3300002509 Bacteria 17362
27 Ga0466718_062522 3300042617 Bacteria 10003
28 Ga0466717_219391 3300042604 Bacteria 1254
29 Ga0466722_177157 3300042609 Bacteria 4169
30 Ga0466690_361437 3300042590 Bacteria 2005
31 Ga0466694_083994 3300042594 Bacteria 1269
32 Ga0123353_10214081 3300010167 Bacteria 3020
33 Ga0466734_033826 3300042623 Bacteria 2058
34 Ga0466703_093994 3300042636 Bacteria 1148
35 Ga0466704_290883 3300042643 Bacteria 1456
36 Ga0466727_085559 3300042655 Bacteria 1830
37 JGI24698J34947_10019314 3300002449 Archaea 3676
38 JGI24698J34947_10029172 3300002449 Bacteria 2917
39 JGI24698J34947_10049758 3300002449 Bacteria 2116
40 JGI24698J34947_10074158 3300002449 Bacteria 1622
41 JGI24698J34947_10349296 3300002449 Bacteria 518
42 Ga0466715_527708 3300042616 Bacteria 1087
43 Ga0466718_000677 3300042617 Bacteria 10081
44 Ga0466718_012538 3300042617 Archaea 1126
45 Ga0466719_149218 3300042606 Bacteria 2486
46 Ga0466722_121638 3300042609 Bacteria 1081
47 Ga0466690_089996 3300042590 Unclassified 11134
48 Ga0123353_10525315 3300010167 Bacteria 1716
49 Ga0123353_10583411 3300010167 Bacteria 1603
50 Ga0466731_149283 3300042622 Bacteria 1023
51 JGI24698J34947_10009223 3300002449 Bacteria 5414
52 JGI24698J34947_10058347 3300002449 Bacteria 1912
53 JGI24698J34947_10085324 3300002449 Bacteria 1467
54 JGI24698J34947_10090276 3300002449 Bacteria 1408
55 JGI24698J34947_10303472 3300002449 Bacteria 574
56 JGI24698J34947_10304165 3300002449 Unclassified 573
57 JGI24695J34938_10083947 3300002450 Bacteria 1313
58 JGI24695J34938_10302091 3300002450 Bacteria 692
59 JGI24695J34938_10607216 3300002450 Bacteria 510
60 JGI24699J35502_10911972 3300002509 Unclassified 1073
61 Ga0466712_301991 3300042614 Bacteria 3268
62 Ga0466728_088189 3300042620 Bacteria 1897
63 Ga0466705_081287 3300042612 Bacteria 2179
64 Ga0466732_431326 3300042656 Bacteria 1046
65 Ga0466701_094628 3300042598 Bacteria 2044
66 Ga0466700_492639 3300042600 Bacteria 1665
67 Ga0466719_477789 3300042606 Bacteria 1320
68 Ga0466694_053473 3300042594 Bacteria 2281
69 Ga0466699_056266 3300042597 Bacteria 1466
70 Ga0466731_149500 3300042622 Bacteria 16596
71 Ga0466702_020814 3300042635 Bacteria 1263
72 Ga0466703_163125 3300042636 Bacteria 1502
73 Ga0466708_051128 3300042652 Bacteria 1049
74 JGI24698J34947_10041986 3300002449 Bacteria 2352
75 JGI24698J34947_10089770 3300002449 Bacteria 1413
76 JGI24695J34938_10203820 3300002450 Bacteria 825
77 JGI24695J34938_10499754 3300002450 Bacteria 556
78 JGI24697J35500_11083695 3300002507 Unclassified 1118
79 Ga0072940_1019399 3300005200 Bacteria 3492
80 Ga0466711_227333 3300042615 Bacteria 1776
81 Ga0466697_161551 3300042611 Archaea 4551
82 Ga0466705_037563 3300042612 Bacteria 14225
83 Ga0466713_144475 3300042602 Bacteria 2035
84 Ga0466716_508509 3300042605 Bacteria 1612
85 Ga0466690_049471 3300042590 Bacteria 7569
86 Ga0466699_144362 3300042597 Bacteria 1552
87 Ga0123353_11541670 3300010167 Bacteria 843
88 AustNasuHG_c1013926 3300000089 Unclassified 2748
89 AustNasuHG_c1015134 3300000089 Unclassified 2608
90 JGI24698J34947_10001059 3300002449 Bacteria 14178
91 JGI24698J34947_10034005 3300002449 Bacteria 2670
92 JGI24698J34947_10062780 3300002449 Bacteria 1823
93 JGI24698J34947_10300161 3300002449 Bacteria 579
94 JGI24695J34938_10459556 3300002450 Bacteria 576
95 JGI24700J35501_10930800 3300002508 Bacteria 24704
96 Ga0466712_138866 3300042614 Bacteria 1192
97 Ga0466712_242645 3300042614 Bacteria 1032
98 Ga0466711_183055 3300042615 Bacteria 2342
99 Ga0466690_277976 3300042590 Bacteria 1831
100 Ga0466691_052731 3300042593 Bacteria 5150
101 Ga0466694_109281 3300042594 Bacteria 2067
102 Ga0466699_008504 3300042597 Bacteria 1455
103 Ga0123355_10325973 3300009826 Archaea 2063
104 Ga0123356_10008000 3300010049 Bacteria 10520
105 Ga0123356_10123652 3300010049 Bacteria 2522
106 Ga0123353_10761202 3300010167 Bacteria 1346
107 Ga0123353_11776405 3300010167 Bacteria 768
108 Ga0123353_12157030 3300010167 Bacteria 676
109 Ga0466731_007712 3300042622 Bacteria 1438
110 Ga0466704_442133 3300042643 Bacteria 25213
111 Ga0466704_584739 3300042643 Bacteria 2407
112 Ga0466709_376506 3300042648 Bacteria 3637
113 Ga0466727_215699 3300042655 Bacteria 2354
114 AustNasuHG_c1007826 3300000089 Bacteria 3791
115 JGI24698J34947_10140492 3300002449 Bacteria 1018
116 JGI24698J34947_10243731 3300002449 Bacteria 676
117 JGI24698J34947_10340564 3300002449 Bacteria 528
118 JGI24695J34938_10086815 3300002450 Bacteria 1287
119 JGI24695J34938_10193770 3300002450 Bacteria 845
120 JGI24705J35276_11759109 3300002504 Bacteria 661
121 Ga0466705_441813 3300042612 Bacteria 3067
122 Ga0466705_450858 3300042612 Bacteria 1142
123 Ga0466712_065771 3300042614 Bacteria 2566
124 Ga0466718_087001 3300042617 Unclassified 2527
125 Ga0466726_083597 3300042619 Bacteria 1724
126 Ga0466728_041140 3300042620 Bacteria 3337
127 Ga0466705_080198 3300042612 Bacteria 1609
128 Ga0466732_042522 3300042656 Bacteria 15039
129 Ga0466716_050335 3300042605 Bacteria 1459
130 Ga0466698_001768 3300042610 Bacteria 13022
131 Ga0466690_248817 3300042590 Bacteria 1979
132 Ga0466692_041817 3300042591 Bacteria 11196
133 Ga0466694_354493 3300042594 Bacteria 1146
134 Ga0466696_362999 3300042596 Bacteria 7087
135 Ga0466696_437245 3300042596 Bacteria 1406
136 Ga0123356_12385303 3300010049 Bacteria 662
137 Ga0123353_10193457 3300010167 Bacteria 3208
138 Ga0123353_10550655 3300010167 Bacteria 1664
139 Ga0123353_10879169 3300010167 Bacteria 1223
140 Ga0466734_108230 3300042623 Bacteria 1272
141 Ga0466704_428298 3300042643 Bacteria 1067
142 JGI24698J34947_10023275 3300002449 Bacteria 3315
143 JGI24698J34947_10083976 3300002449 Bacteria 1484
144 JGI24695J34938_10015870 3300002450 Bacteria 3851
145 JGI24695J34938_10039494 3300002450 Bacteria 2131
146 JGI24695J34938_10086817 3300002450 Bacteria 1287
147 JGI24695J34938_10308741 3300002450 Bacteria 685
148 Ga0466712_018741 3300042614 Unclassified 8577
149 Ga0466712_157993 3300042614 Bacteria 5029
150 Ga0466712_249148 3300042614 Bacteria 3266
151 Ga0466726_311628 3300042619 Bacteria 3392
152 Ga0466728_205990 3300042620 Bacteria 2220

📋 Family Sequences

#SampleScaffoldProteinLength (aa)
1 3300042610 Ga0466698_001768 Ga0466698_001768_513_875 120
2 3300042614 Ga0466712_181014 Ga0466712_181014_245_610 121
3 3300042591 Ga0466692_041817 Ga0466692_041817_8936_9307 123
4 3300042605 Ga0466716_508509 Ga0466716_508509_614_985 123
5 3300005200 Ga0072940_1019399 Ga0072940_10193997 124
6 3300024493 Ga0264413_112777 Ga0264413_1127773 124
7 3300042590 Ga0466690_049471 Ga0466690_049471_2246_2623 125
8 3300042617 Ga0466718_000677 Ga0466718_000677_1293_1670 125
9 3300042620 Ga0466728_205990 Ga0466728_205990_680_1057 125
10 3300042656 Ga0466732_431326 Ga0466732_431326_482_859 125
11 3300002449 JGI24698J34947_10349296 JGI24698J34947_103492961 126
12 3300002450 JGI24695J34938_10607216 JGI24695J34938_106072161 126
13 3300010049 Ga0123356_10008000 Ga0123356_100080008 126
14 3300010167 Ga0123353_10583411 Ga0123353_105834113 126
15 3300042593 Ga0466691_050389 Ga0466691_050389_590_970 126
16 3300042593 Ga0466691_052731 Ga0466691_052731_4039_4419 126
17 3300042596 Ga0466696_362999 Ga0466696_362999_3930_4310 126
18 3300042614 Ga0466712_301991 Ga0466712_301991_258_638 126
19 iso_pr_bacteria 2781125689 2781426842 126
20 3300002449 JGI24698J34947_10049758 JGI24698J34947_100497583 127
21 3300002449 JGI24698J34947_10140492 JGI24698J34947_101404922 127
22 3300002450 JGI24695J34938_10086817 JGI24695J34938_100868173 127
23 3300002450 JGI24695J34938_10203820 JGI24695J34938_102038202 127
24 3300002509 JGI24699J35502_11133860 JGI24699J35502_111338605 127
25 3300042590 Ga0466690_361437 Ga0466690_361437_1011_1394 127
26 3300042594 Ga0466694_257216 Ga0466694_257216_411_794 127
27 3300042596 Ga0466696_117648 Ga0466696_117648_1419_1802 127
28 3300042622 Ga0466731_226223 Ga0466731_226223_532_915 127
29 3300042656 Ga0466732_042522 Ga0466732_042522_1137_1520 127
30 3300002449 JGI24698J34947_10142761 JGI24698J34947_101427611 128
31 3300002449 JGI24698J34947_10243731 JGI24698J34947_102437312 128
32 3300002507 JGI24697J35500_11083695 JGI24697J35500_110836953 128
33 3300002509 JGI24699J35502_10911972 JGI24699J35502_109119723 128
34 3300010049 Ga0123356_10123652 Ga0123356_101236522 128
35 3300010049 Ga0123356_12385303 Ga0123356_123853032 128
36 3300010167 Ga0123353_11541670 Ga0123353_115416701 128
37 3300042609 Ga0466722_121638 Ga0466722_121638_451_837 128
38 3300042614 Ga0466712_065771 Ga0466712_065771_91_477 128
39 3300042614 Ga0466712_138866 Ga0466712_138866_494_880 128
40 3300042614 Ga0466712_264621 Ga0466712_264621_516_902 128
41 3300042636 Ga0466703_163125 Ga0466703_163125_497_883 128
42 3300000089 AustNasuHG_c1013926 AustNasuHG_10139264 129
43 3300002449 JGI24698J34947_10019314 JGI24698J34947_100193144 129
44 3300002449 JGI24698J34947_10062780 JGI24698J34947_100627805 129
45 3300002449 JGI24698J34947_10089770 JGI24698J34947_100897702 129
46 3300002449 JGI24698J34947_10300161 JGI24698J34947_103001611 129
47 3300002449 JGI24698J34947_10340564 JGI24698J34947_103405641 129
48 3300005071 Ga0068302_10315147 Ga0068302_103151471 129
49 3300042590 Ga0466690_248817 Ga0466690_248817_897_1286 129
50 3300042597 Ga0466699_144362 Ga0466699_144362_101_490 129
51 3300042600 Ga0466700_492639 Ga0466700_492639_1254_1643 129
52 3300042604 Ga0466717_219391 Ga0466717_219391_571_960 129
53 3300042605 Ga0466716_050335 Ga0466716_050335_186_575 129
54 3300042609 Ga0466722_177157 Ga0466722_177157_1735_2124 129
55 3300042612 Ga0466705_450858 Ga0466705_450858_655_1044 129
56 3300042614 Ga0466712_242645 Ga0466712_242645_155_544 129
57 3300042614 Ga0466712_249148 Ga0466712_249148_132_521 129
58 3300042620 Ga0466728_088189 Ga0466728_088189_499_888 129
59 3300042623 Ga0466734_033826 Ga0466734_033826_976_1365 129
60 3300042648 Ga0466709_376506 Ga0466709_376506_2499_2888 129
61 3300042652 Ga0466708_051128 Ga0466708_051128_134_523 129
62 3300042655 Ga0466727_085559 Ga0466727_085559_1392_1781 129
63 3300000089 AustNasuHG_c1015134 AustNasuHG_10151343 130
64 3300002449 JGI24698J34947_10034005 JGI24698J34947_100340053 130
65 3300002449 JGI24698J34947_10074158 JGI24698J34947_100741582 130
66 3300002449 JGI24698J34947_10085324 JGI24698J34947_100853243 130
67 3300002449 JGI24698J34947_10090276 JGI24698J34947_100902762 130
68 3300002449 JGI24698J34947_10171785 JGI24698J34947_101717852 130
69 3300002450 JGI24695J34938_10086815 JGI24695J34938_100868152 130
70 3300002504 JGI24705J35276_11759109 JGI24705J35276_117591092 130
71 3300024493 Ga0264413_101478 Ga0264413_1014783 130
72 3300042594 Ga0466694_053473 Ga0466694_053473_1766_2158 130
73 3300042594 Ga0466694_109281 Ga0466694_109281_962_1354 130
74 3300042594 Ga0466694_354493 Ga0466694_354493_684_1076 130
75 3300042612 Ga0466705_080198 Ga0466705_080198_929_1321 130
76 3300042614 Ga0466712_157993 Ga0466712_157993_3766_4158 130
77 3300042615 Ga0466711_120956 Ga0466711_120956_280_672 130
78 3300042617 Ga0466718_062522 Ga0466718_062522_9487_9879 130
79 3300042655 Ga0466727_215699 Ga0466727_215699_278_670 130
80 iso_pr_bacteria 2819994798 2819997509 130
81 3300002449 JGI24698J34947_10001059 JGI24698J34947_100010596 131
82 3300002449 JGI24698J34947_10009223 JGI24698J34947_1000922312 131
83 3300002449 JGI24698J34947_10029172 JGI24698J34947_100291724 131
84 3300002449 JGI24698J34947_10041986 JGI24698J34947_100419863 131
85 3300002449 JGI24698J34947_10083976 JGI24698J34947_100839763 131
86 3300002449 JGI24698J34947_10303472 JGI24698J34947_103034722 131
87 3300002449 JGI24698J34947_10304085 JGI24698J34947_103040851 131
88 3300002449 JGI24698J34947_10304165 JGI24698J34947_103041651 131
89 3300002450 JGI24695J34938_10094968 JGI24695J34938_100949682 131
90 3300002508 JGI24700J35501_10930800 JGI24700J35501_1093080013 131
91 3300010167 Ga0123353_10193457 Ga0123353_101934574 131
92 3300010167 Ga0123353_10879169 Ga0123353_108791693 131
93 3300010167 Ga0123353_11776405 Ga0123353_117764051 131
94 3300042597 Ga0466699_008504 Ga0466699_008504_463_858 131
95 3300042598 Ga0466701_094628 Ga0466701_094628_430_825 131
96 3300042608 Ga0466721_011515 Ga0466721_011515_545_940 131
97 3300042610 Ga0466698_452728 Ga0466698_452728_218_613 131
98 3300042615 Ga0466711_227333 Ga0466711_227333_47_442 131
99 3300042617 Ga0466718_012538 Ga0466718_012538_64_459 131
100 3300042619 Ga0466726_083597 Ga0466726_083597_863_1258 131
101 3300042655 Ga0466727_085982 Ga0466727_085982_337_732 131
102 3300002449 JGI24698J34947_10023275 JGI24698J34947_100232753 132
103 3300002449 JGI24698J34947_10058347 JGI24698J34947_100583473 132
104 3300002450 JGI24695J34938_10056908 JGI24695J34938_100569082 132
105 3300002450 JGI24695J34938_10083947 JGI24695J34938_100839472 132
106 3300002450 JGI24695J34938_10193770 JGI24695J34938_101937702 132
107 3300002450 JGI24695J34938_10204058 JGI24695J34938_102040582 132
108 3300002450 JGI24695J34938_10308741 JGI24695J34938_103087412 132
109 3300002509 JGI24699J35502_10941383 JGI24699J35502_109413832 132
110 3300010049 Ga0123356_10585469 Ga0123356_105854693 132
111 3300010167 Ga0123353_10761202 Ga0123353_107612021 132
112 3300042606 Ga0466719_477789 Ga0466719_477789_470_868 132
113 3300042611 Ga0466697_161551 Ga0466697_161551_338_736 132
114 3300042612 Ga0466705_037563 Ga0466705_037563_12350_12748 132
115 3300042616 Ga0466715_527708 Ga0466715_527708_453_851 132
116 3300042617 Ga0466718_087001 Ga0466718_087001_2034_2432 132
117 3300042619 Ga0466726_311628 Ga0466726_311628_1152_1550 132
118 3300042620 Ga0466728_041140 Ga0466728_041140_2777_3175 132
119 3300042622 Ga0466731_007712 Ga0466731_007712_98_496 132
120 3300042622 Ga0466731_149283 Ga0466731_149283_352_750 132
121 3300042622 Ga0466731_149500 Ga0466731_149500_200_598 132
122 3300042636 Ga0466703_093994 Ga0466703_093994_273_671 132
123 3300042643 Ga0466704_290883 Ga0466704_290883_931_1329 132
124 3300042643 Ga0466704_442133 Ga0466704_442133_15770_16168 132
125 iso_pr_bacteria 2781125652 2781312075 132
126 3300002450 JGI24695J34938_10162966 JGI24695J34938_101629662 133
127 3300002450 JGI24695J34938_10459556 JGI24695J34938_104595561 133
128 3300010167 Ga0123353_12873311 Ga0123353_128733111 133
129 3300042590 Ga0466690_089996 Ga0466690_089996_4395_4796 133
130 3300042602 Ga0466713_144475 Ga0466713_144475_179_580 133
131 3300042623 Ga0466734_108230 Ga0466734_108230_243_644 133
132 3300002450 JGI24695J34938_10015870 JGI24695J34938_100158704 134
133 3300002450 JGI24695J34938_10039494 JGI24695J34938_100394941 134
134 3300002450 JGI24695J34938_10302091 JGI24695J34938_103020911 134
135 3300009826 Ga0123355_10325973 Ga0123355_103259732 134
136 3300010167 Ga0123353_10214081 Ga0123353_102140812 134
137 3300010167 Ga0123353_10550655 Ga0123353_105506553 134
138 3300010167 Ga0123353_12157030 Ga0123353_121570302 134
139 3300042597 Ga0466699_056266 Ga0466699_056266_526_930 134
140 3300000089 AustNasuHG_c1007826 AustNasuHG_10078265 135
141 3300010049 Ga0123356_11338634 Ga0123356_113386341 135
142 3300042612 Ga0466705_081287 Ga0466705_081287_59_466 135
143 3300042615 Ga0466711_183055 Ga0466711_183055_1296_1703 135
144 3300042643 Ga0466704_428298 Ga0466704_428298_130_537 135
145 3300010167 Ga0123353_10525315 Ga0123353_105253153 136
146 3300042590 Ga0466690_277976 Ga0466690_277976_924_1334 136
147 3300042635 Ga0466702_020814 Ga0466702_020814_549_959 136
148 3300042643 Ga0466704_584739 Ga0466704_584739_290_700 136
149 3300042612 Ga0466705_441813 Ga0466705_441813_2595_3008 137
150 3300042614 Ga0466712_018741 Ga0466712_018741_2534_2947 137
151 3300002449 JGI24698J34947_10031575 JGI24698J34947_100315753 138
152 3300042596 Ga0466696_437245 Ga0466696_437245_254_673 139
153 3300002450 JGI24695J34938_10499754 JGI24695J34938_104997541 140
154 3300042594 Ga0466694_083994 Ga0466694_083994_621_1049 142
155 3300042606 Ga0466719_149218 Ga0466719_149218_1763_2212 149

🧩 MSA Aligner

Download FASTA Download Aligned FASTA

🔬 Functional Annotation

PFAM IDNameDescriptionStartEndAccuracy
PF05168 HEPN HEPN domain 4 117 0.96

⚛️ Structure & Feature Viewer

pLDDTpTMQuality
0.77 0.81 High

Powered by Feature Viewer

Powered by PDBe Molstar

Download CIF

🗺️ Geographic Distribution

Some samples may be missing due to lack of coordinate data.