Protein Family IF06488
Metagenome
Isolate
124
Members
40
Samples
120
Scaffolds
477.79
Avg Length
Representative Sequence
- ID
- 3300042606|Ga0466719_130425|Ga0466719_130425_455_1963
- Length
- 502 aa
- Sequence
- MREAQQTADNAEWRPNTSALFTDFYSLTMAHGYWKKNINHRAVFEMFFRRQPFGGGFTVFAGLTDFLEKLKNFHYSPEDIAYLRGLKVFDQGFLDYLSHFRFTGSILALDEGSVVFPQEPLIRVDSSLIECQIIEGMLLNIINFQSLIATKTARVWLASGKGSVLEFGLRRAQGPDGAMSATRAAYIGGAMGTSNTLGGKVYGIPVIGTMAHAWIMAFPSEEEAFQAYADIYPGRTVFLIDTYDTLKSGVPNAIKVGRKLVEQGKNFGVRLDSGDIHYLSVEVRKLLDEAGFPQATITVSNDLDETIIHTLKEAGAPINSWGVGTQMVTGGTEAAFTGVYKLAAKGDGSGRLIPAMKFSDNLEKTTTPGVKQVWRIKDPAGMAVADVLTLEEDPEGPDTLEKGKRYSFWHPAADYRHFYHEISGSVEQGLKPRMEKGELFPGPGLGEIRARVEADLDSFDASYKRLLNPHVYKVSFTDRLRKLKLELINNYLGDLDPQGPVT
Sample Types
Isolate
3.2%
Metagenome
96.8%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Termitidae
35.9%
Kalotermitidae
35.9%
Unclassified
12.8%
Rhinotermitidae
7.7%
Termopsidae
7.7%
Taxonomy
Archaea
0
Bacteria
118
Eukaryota
0
Viruses
0
Unclassified
6
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 2 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 3 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 4 | 3300002450 | Cornitermes sp. P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191 P3 | Metagenome | Termitidae |
| 5 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 6 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 10 | 3300042607 | Termite gut microbial communities of Nasutitermes c.f. ephratae from Petit Saut, French Guiana, France - Nx346 | Metagenome | Termitidae |
| 11 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 12 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 13 | 3300038395 | Termite gut microbial communities from Labiotermes sp. nest - French Guiana - 19_62_13_hindgut | Metagenome | Termitidae |
| 14 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 15 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 16 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 17 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 18 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 19 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 20 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 21 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 22 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 23 | 2781125632 | Treponema sp. Co191P1bin87 | Isolate | Unclassified |
| 24 | 2781125655 | Treponema sp. Emb289P1bin105 | Isolate | Unclassified |
| 25 | 3300009826 | Embiratermes neotenicus P1 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P1 | Metagenome | Termitidae |
| 26 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 27 | 2781125646 | Treponema sp. Co191P3bin59 | Isolate | Unclassified |
| 28 | 2781125647 | Treponema sp. Co191P3bin16 | Isolate | Unclassified |
| 29 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 30 | 3300024493 | Termite gut microbial communities from Nasutitermes sp. lab. nest, Belvaux, Luxembourg - LM_1_8 metagenomics | Metagenome | |
| 31 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 32 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 33 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 34 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 35 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 36 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 37 | 3300005200 | Nasutitermes gut metagenome | Metagenome | Termitidae |
| 38 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 39 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 40 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466705_089647 | 3300042612 | Bacteria | 4167 |
| 2 | Ga0466705_129956 | 3300042612 | Bacteria | 6102 |
| 3 | Ga0466705_509521 | 3300042612 | Unclassified | 4837 |
| 4 | Ga0466715_177257 | 3300042616 | Bacteria | 4707 |
| 5 | Ga0123356_10189576 | 3300010049 | Bacteria | 2086 |
| 6 | Ga0123353_10458081 | 3300010167 | Bacteria | 1875 |
| 7 | Ga0466719_199083 | 3300042606 | Bacteria | 19265 |
| 8 | Ga0466722_073510 | 3300042609 | Bacteria | 10049 |
| 9 | Ga0466735_001466 | 3300042624 | Bacteria | 5844 |
| 10 | Ga0466703_313686 | 3300042636 | Bacteria | 39291 |
| 11 | Ga0466709_217120 | 3300042648 | Unclassified | 13602 |
| 12 | Ga0466708_110857 | 3300042652 | Bacteria | 17356 |
| 13 | Ga0466727_058290 | 3300042655 | Bacteria | 2959 |
| 14 | JGI24695J34938_10000042 | 3300002450 | Bacteria | 95222 |
| 15 | Ga0264413_103200 | 3300024493 | Bacteria | 13813 |
| 16 | Ga0466694_220062 | 3300042594 | Bacteria | 3238 |
| 17 | Ga0466699_132676 | 3300042597 | Bacteria | 5318 |
| 18 | Ga0466705_064002 | 3300042612 | Bacteria | 16007 |
| 19 | Ga0466711_254685 | 3300042615 | Bacteria | 14104 |
| 20 | Ga0466715_101121 | 3300042616 | Bacteria | 10528 |
| 21 | Ga0466728_050842 | 3300042620 | Bacteria | 3113 |
| 22 | Ga0123357_10057600 | 3300009784 | Bacteria | 5221 |
| 23 | Ga0466722_062343 | 3300042609 | Bacteria | 13257 |
| 24 | Ga0466735_133724 | 3300042624 | Bacteria | 1458 |
| 25 | Ga0466703_075318 | 3300042636 | Bacteria | 4524 |
| 26 | Ga0466703_140559 | 3300042636 | Bacteria | 49074 |
| 27 | Ga0466703_409321 | 3300042636 | Bacteria | 56299 |
| 28 | Ga0466704_401846 | 3300042643 | Bacteria | 10351 |
| 29 | Ga0466704_409633 | 3300042643 | Bacteria | 18291 |
| 30 | Ga0466704_537964 | 3300042643 | Bacteria | 2316 |
| 31 | Ga0466709_040343 | 3300042648 | Bacteria | 6770 |
| 32 | Ga0466709_396745 | 3300042648 | Bacteria | 6202 |
| 33 | Ga0072940_1034580 | 3300005200 | Bacteria | 3366 |
| 34 | Ga0264413_101090 | 3300024493 | Bacteria | 21368 |
| 35 | Ga0466692_037966 | 3300042591 | Bacteria | 12197 |
| 36 | Ga0466696_010999 | 3300042596 | Bacteria | 16877 |
| 37 | Ga0466696_065148 | 3300042596 | Bacteria | 3376 |
| 38 | Ga0466699_189430 | 3300042597 | Bacteria | 4827 |
| 39 | Ga0466715_189366 | 3300042616 | Bacteria | 18404 |
| 40 | Ga0466723_198636 | 3300042618 | Bacteria | 33456 |
| 41 | Ga0466726_417747 | 3300042619 | Bacteria | 2082 |
| 42 | Ga0466728_125333 | 3300042620 | Bacteria | 6574 |
| 43 | Ga0466728_157294 | 3300042620 | Bacteria | 9968 |
| 44 | Ga0123355_10003855 | 3300009826 | Bacteria | 21692 |
| 45 | Ga0466719_130425 | 3300042606 | Bacteria | 2432 |
| 46 | Ga0466719_276693 | 3300042606 | Bacteria | 2713 |
| 47 | Ga0466722_075258 | 3300042609 | Bacteria | 10830 |
| 48 | Ga0466722_202638 | 3300042609 | Bacteria | 35532 |
| 49 | Ga0466704_567552 | 3300042643 | Bacteria | 13451 |
| 50 | AustNasuHG_c1005319 | 3300000089 | Bacteria | 4600 |
| 51 | Ga0466690_029331 | 3300042590 | Bacteria | 8628 |
| 52 | Ga0466690_247656 | 3300042590 | Bacteria | 6080 |
| 53 | Ga0466696_012033 | 3300042596 | Bacteria | 20107 |
| 54 | Ga0466696_151220 | 3300042596 | Bacteria | 13717 |
| 55 | Ga0466696_231711 | 3300042596 | Bacteria | 11281 |
| 56 | Ga0466715_138125 | 3300042616 | Bacteria | 8210 |
| 57 | Ga0466729_172903 | 3300042621 | Bacteria | 1888 |
| 58 | Ga0123353_10197639 | 3300010167 | Bacteria | 3168 |
| 59 | Ga0466716_091524 | 3300042605 | Bacteria | 16263 |
| 60 | Ga0466719_483653 | 3300042606 | Bacteria | 4077 |
| 61 | Ga0466720_091377 | 3300042607 | Bacteria | 7368 |
| 62 | Ga0466722_100074 | 3300042609 | Bacteria | 6920 |
| 63 | Ga0466703_024587 | 3300042636 | Bacteria | 6305 |
| 64 | Ga0466709_231941 | 3300042648 | Bacteria | 3435 |
| 65 | Ga0466727_300064 | 3300042655 | Bacteria | 10337 |
| 66 | JGI24695J34938_10001312 | 3300002450 | Bacteria | 21662 |
| 67 | JGI24695J34938_10005234 | 3300002450 | Bacteria | 8177 |
| 68 | Ga0466694_286953 | 3300042594 | Bacteria | 41499 |
| 69 | Ga0466696_304174 | 3300042596 | Bacteria | 1725 |
| 70 | Ga0466705_105191 | 3300042612 | Bacteria | 20972 |
| 71 | Ga0466705_369622 | 3300042612 | Bacteria | 26304 |
| 72 | Ga0466723_056839 | 3300042618 | Bacteria | 12967 |
| 73 | Ga0466728_118578 | 3300042620 | Bacteria | 8729 |
| 74 | Ga0466720_069001 | 3300042607 | Bacteria | 13682 |
| 75 | Ga0466704_296077 | 3300042643 | Unclassified | 3507 |
| 76 | Ga0466709_080861 | 3300042648 | Unclassified | 8919 |
| 77 | Ga0466708_173976 | 3300042652 | Bacteria | 9149 |
| 78 | Ga0466708_416996 | 3300042652 | Bacteria | 3693 |
| 79 | Ga0466691_019176 | 3300042593 | Bacteria | 33350 |
| 80 | Ga0466691_130929 | 3300042593 | Bacteria | 17359 |
| 81 | Ga0466695_366562 | 3300042595 | Bacteria | 7991 |
| 82 | Ga0466699_438480 | 3300042597 | Bacteria | 45456 |
| 83 | Ga0466705_184015 | 3300042612 | Bacteria | 7444 |
| 84 | Ga0466716_199747 | 3300042605 | Bacteria | 4644 |
| 85 | Ga0466716_517262 | 3300042605 | Bacteria | 4059 |
| 86 | Ga0466719_184325 | 3300042606 | Unclassified | 9074 |
| 87 | Ga0466722_240313 | 3300042609 | Bacteria | 4693 |
| 88 | Ga0466703_015135 | 3300042636 | Bacteria | 49157 |
| 89 | Ga0466704_426951 | 3300042643 | Bacteria | 34972 |
| 90 | Ga0466708_234738 | 3300042652 | Bacteria | 19411 |
| 91 | JGI24702J35022_10000370 | 3300002462 | Bacteria | 26677 |
| 92 | Ga0466696_142612 | 3300042596 | Bacteria | 4508 |
| 93 | Ga0466711_202959 | 3300042615 | Bacteria | 30412 |
| 94 | Ga0466718_047819 | 3300042617 | Unclassified | 1184 |
| 95 | Ga0466726_030734 | 3300042619 | Bacteria | 2078 |
| 96 | Ga0466726_399508 | 3300042619 | Bacteria | 2470 |
| 97 | Ga0123353_10021612 | 3300010167 | Bacteria | 9662 |
| 98 | Ga0466707_161334 | 3300042601 | Bacteria | 3624 |
| 99 | Ga0466716_076460 | 3300042605 | Bacteria | 6182 |
| 100 | Ga0466719_362189 | 3300042606 | Bacteria | 6764 |
| 101 | Ga0466722_123343 | 3300042609 | Bacteria | 31379 |
| 102 | Ga0466703_097237 | 3300042636 | Bacteria | 9615 |
| 103 | Ga0466703_099313 | 3300042636 | Bacteria | 6715 |
| 104 | Ga0466703_135593 | 3300042636 | Bacteria | 14337 |
| 105 | Ga0466704_076746 | 3300042643 | Bacteria | 10665 |
| 106 | Ga0466704_099104 | 3300042643 | Bacteria | 24492 |
| 107 | Ga0466704_151874 | 3300042643 | Bacteria | 14749 |
| 108 | Ga0466727_154496 | 3300042655 | Bacteria | 3543 |
| 109 | Ga0466727_299598 | 3300042655 | Bacteria | 13678 |
| 110 | JGI24695J34938_10000044 | 3300002450 | Bacteria | 93214 |
| 111 | Ga0466690_248693 | 3300042590 | Bacteria | 9161 |
| 112 | Ga0466692_140863 | 3300042591 | Bacteria | 8775 |
| 113 | Ga0466711_397261 | 3300042615 | Bacteria | 11139 |
| 114 | Ga0466715_189786 | 3300042616 | Bacteria | 2591 |
| 115 | Ga0466726_114674 | 3300042619 | Bacteria | 4588 |
| 116 | Ga0466728_158641 | 3300042620 | Bacteria | 5806 |
| 117 | Ga0466708_135822 | 3300042652 | Bacteria | 13393 |
| 118 | Ga0466708_208309 | 3300042652 | Bacteria | 15912 |
| 119 | AustNasuHG_c1004979 | 3300000089 | Bacteria | 4754 |
| 120 | Ga0415639_074643 | 3300038395 | Bacteria | 6059 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.