Protein Family IF06424
Metagenome
Isolate
199
Members
42
Samples
193
Scaffolds
404.5
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_463671|Ga0466716_463671_677_2035
- Length
- 452 aa
- Sequence
- MRKPVRKQVSRRLAMRRYYLHTRHGIYYAELVTPEGRKLNAGGPIDWRPVKADNGYMNKPFFFLLIXXXXLPAGAEQFFYKYETGNKYRIVSVVNEDVYINRRFSHRARILNRSAVEIGEVTGDTAEYKANFQTAEQILEGSGSFQWSMEYDSVFQQDKFGRMIIDDRYYMPVVRNVPVFPDRDLKEGEAWTAEGHEMHDFRTSFGIEEPYRIPFEADYVFLGNRVWKGKSYPAFSVSYRIFYEPRAVPGKVWPRRIMGASDQIVYWDTELGQAAAYDESFRMVFELSSGSTVEYRGRAEAEIIESEIMKKEEVAKEIADEIAKLGIDDASVRIVDEGITISLENVQFQPDSAILFESEKTKLDKIGEILLKYPERDILVGGHTALAGTAAGRQKLSLERAAAVSDYLILKKVRGPSHVVVRGYGADRPVADNSTAAGMRKNRRVEIILLEN
Sample Types
Isolate
3.0%
Metagenome
97.0%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
33.3%
Termitidae
31.0%
Unclassified
16.7%
Termopsidae
9.5%
Rhinotermitidae
9.5%
Taxonomy
Archaea
0
Bacteria
191
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2781125629 | Treponema sp. Nt197P3bin20 | Isolate | Unclassified |
| 2 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 3 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 4 | 3300042622 | Termite gut microbial communities of Spinitermes trispinosus from Petit Saut, French Guiana, France - Spi319 | Metagenome | Termitidae |
| 5 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 6 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 7 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 8 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 9 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 10 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 11 | 2781125687 | Treponema sp. Lab288P4bin29 | Isolate | Unclassified |
| 12 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 13 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 14 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 15 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 16 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 17 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 18 | 3300042597 | Termite gut microbial communities of Cylindrotermes parvignathus from Petit Saut, French Guiana, France - Cyl330 | Metagenome | Termitidae |
| 19 | 3300042614 | Termite gut microbial communities of Microcerotermes sp. from Ebogo II, Mbalmayo, Cameroon - Mcx344 | Metagenome | Termitidae |
| 20 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 21 | 2781125630 | Treponema sp. Nt197P3bin60 | Isolate | Unclassified |
| 22 | 3300000089 | Insect hindgut associated microbial communities from Australia - Nasutitermes | Metagenome | Termitidae |
| 23 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 24 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 25 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 26 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 27 | 650716099 | Leadbettera azotonutricia ZAS-9 | Isolate | Unclassified |
| 28 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 29 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 30 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 31 | 3300042595 | Termite gut microbial communities of Crepititermes verruculosus from Petit Saut, French Guiana, France - Crp329 | Metagenome | Termitidae |
| 32 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 33 | 2781125688 | Treponema sp. Lab288P4bin13 | Isolate | Unclassified |
| 34 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 35 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 36 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 37 | 2781125663 | Treponema sp. Emb289P3bin135 | Isolate | Unclassified |
| 38 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 39 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 40 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 41 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 42 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466733_116890 | 3300042659 | Bacteria | 2727 |
| 2 | Ga0466712_164592 | 3300042614 | Bacteria | 16944 |
| 3 | Ga0466715_072360 | 3300042616 | Bacteria | 12409 |
| 4 | Ga0466715_238614 | 3300042616 | Bacteria | 3554 |
| 5 | Ga0466718_160103 | 3300042617 | Bacteria | 5073 |
| 6 | Ga0466723_069081 | 3300042618 | Bacteria | 3578 |
| 7 | Ga0466726_204276 | 3300042619 | Bacteria | 3070 |
| 8 | Ga0466726_363999 | 3300042619 | Bacteria | 2961 |
| 9 | Ga0466690_236189 | 3300042590 | Bacteria | 8267 |
| 10 | Ga0466692_009735 | 3300042591 | Bacteria | 6259 |
| 11 | Ga0466735_004771 | 3300042624 | Bacteria | 23553 |
| 12 | Ga0466735_073907 | 3300042624 | Bacteria | 4128 |
| 13 | Ga0466703_249993 | 3300042636 | Bacteria | 2750 |
| 14 | Ga0466704_127272 | 3300042643 | Bacteria | 2505 |
| 15 | Ga0466704_273563 | 3300042643 | Bacteria | 5160 |
| 16 | Ga0466709_146685 | 3300042648 | Bacteria | 3761 |
| 17 | Ga0466727_051490 | 3300042655 | Bacteria | 3577 |
| 18 | Ga0466727_052851 | 3300042655 | Bacteria | 1449 |
| 19 | Ga0466707_312690 | 3300042601 | Bacteria | 2500 |
| 20 | Ga0466716_020334 | 3300042605 | Bacteria | 2072 |
| 21 | Ga0466716_044468 | 3300042605 | Bacteria | 5057 |
| 22 | Ga0466719_276795 | 3300042606 | Unclassified | 1204 |
| 23 | Ga0466719_290677 | 3300042606 | Bacteria | 13941 |
| 24 | Ga0466722_053013 | 3300042609 | Bacteria | 5953 |
| 25 | Ga0466705_199111 | 3300042612 | Bacteria | 3368 |
| 26 | Ga0466733_002803 | 3300042659 | Bacteria | 38582 |
| 27 | Ga0466711_051243 | 3300042615 | Bacteria | 39713 |
| 28 | Ga0466723_029552 | 3300042618 | Bacteria | 2559 |
| 29 | Ga0466726_075614 | 3300042619 | Bacteria | 10342 |
| 30 | Ga0466726_148083 | 3300042619 | Bacteria | 11579 |
| 31 | Ga0466726_345423 | 3300042619 | Bacteria | 7911 |
| 32 | Ga0466726_452940 | 3300042619 | Bacteria | 1373 |
| 33 | Ga0466728_155859 | 3300042620 | Bacteria | 5227 |
| 34 | Ga0123356_10009662 | 3300010049 | Bacteria | 9515 |
| 35 | Ga0466692_171695 | 3300042591 | Bacteria | 2158 |
| 36 | Ga0466691_171472 | 3300042593 | Bacteria | 4877 |
| 37 | Ga0466704_055884 | 3300042643 | Bacteria | 73215 |
| 38 | Ga0466704_560986 | 3300042643 | Bacteria | 4874 |
| 39 | Ga0466709_357472 | 3300042648 | Bacteria | 2873 |
| 40 | Ga0466727_136260 | 3300042655 | Bacteria | 17106 |
| 41 | Ga0466727_299943 | 3300042655 | Bacteria | 2909 |
| 42 | Ga0466716_033267 | 3300042605 | Bacteria | 11071 |
| 43 | Ga0466719_377197 | 3300042606 | Bacteria | 3671 |
| 44 | Ga0466711_001519 | 3300042615 | Bacteria | 36988 |
| 45 | Ga0466711_056195 | 3300042615 | Bacteria | 4968 |
| 46 | Ga0466715_067353 | 3300042616 | Bacteria | 18138 |
| 47 | Ga0466715_346691 | 3300042616 | Bacteria | 5625 |
| 48 | Ga0466718_163367 | 3300042617 | Bacteria | 4793 |
| 49 | Ga0466723_113394 | 3300042618 | Bacteria | 8374 |
| 50 | Ga0466723_189077 | 3300042618 | Bacteria | 2736 |
| 51 | Ga0466723_254512 | 3300042618 | Bacteria | 15504 |
| 52 | Ga0466728_326917 | 3300042620 | Bacteria | 3635 |
| 53 | Ga0123353_10133056 | 3300010167 | Bacteria | 3990 |
| 54 | Ga0466690_283450 | 3300042590 | Bacteria | 2702 |
| 55 | Ga0466691_056031 | 3300042593 | Bacteria | 16056 |
| 56 | Ga0466695_352283 | 3300042595 | Bacteria | 5679 |
| 57 | Ga0466696_342168 | 3300042596 | Bacteria | 4059 |
| 58 | Ga0466699_215395 | 3300042597 | Bacteria | 15587 |
| 59 | Ga0466703_068177 | 3300042636 | Bacteria | 12227 |
| 60 | Ga0466703_278021 | 3300042636 | Bacteria | 19324 |
| 61 | Ga0466709_249445 | 3300042648 | Bacteria | 6094 |
| 62 | Ga0466709_411423 | 3300042648 | Bacteria | 4099 |
| 63 | Ga0466708_018040 | 3300042652 | Bacteria | 25323 |
| 64 | Ga0466708_028258 | 3300042652 | Bacteria | 15218 |
| 65 | Ga0466708_332748 | 3300042652 | Bacteria | 3242 |
| 66 | Ga0466708_376945 | 3300042652 | Bacteria | 1643 |
| 67 | Ga0466708_440835 | 3300042652 | Bacteria | 4235 |
| 68 | Ga0466727_083018 | 3300042655 | Bacteria | 6659 |
| 69 | Ga0123357_10003028 | 3300009784 | Bacteria | 19031 |
| 70 | Ga0466719_063850 | 3300042606 | Bacteria | 14644 |
| 71 | Ga0466722_055826 | 3300042609 | Bacteria | 5942 |
| 72 | Ga0466722_061348 | 3300042609 | Bacteria | 28035 |
| 73 | Ga0466705_035843 | 3300042612 | Bacteria | 27929 |
| 74 | Ga0466705_166609 | 3300042612 | Unclassified | 1486 |
| 75 | Ga0466705_259831 | 3300042612 | Bacteria | 5243 |
| 76 | Ga0466733_046948 | 3300042659 | Bacteria | 19911 |
| 77 | Ga0466711_284444 | 3300042615 | Unclassified | 6605 |
| 78 | Ga0466715_221568 | 3300042616 | Bacteria | 4625 |
| 79 | Ga0466718_023604 | 3300042617 | Bacteria | 14367 |
| 80 | Ga0466723_055496 | 3300042618 | Bacteria | 1505 |
| 81 | Ga0466723_261254 | 3300042618 | Bacteria | 8188 |
| 82 | Ga0466726_092901 | 3300042619 | Bacteria | 7845 |
| 83 | Ga0466728_356485 | 3300042620 | Bacteria | 11391 |
| 84 | Ga0466690_146944 | 3300042590 | Bacteria | 20499 |
| 85 | Ga0466692_147018 | 3300042591 | Bacteria | 18421 |
| 86 | Ga0466692_175784 | 3300042591 | Bacteria | 25241 |
| 87 | Ga0466691_031548 | 3300042593 | Bacteria | 19852 |
| 88 | Ga0466694_017850 | 3300042594 | Bacteria | 32795 |
| 89 | Ga0466696_184057 | 3300042596 | Bacteria | 30206 |
| 90 | Ga0466731_150088 | 3300042622 | Unclassified | 6759 |
| 91 | Ga0466730_033016 | 3300042625 | Bacteria | 1507 |
| 92 | Ga0466703_010256 | 3300042636 | Bacteria | 1874 |
| 93 | Ga0466703_112066 | 3300042636 | Bacteria | 4284 |
| 94 | Ga0466703_414830 | 3300042636 | Bacteria | 14541 |
| 95 | Ga0466704_259037 | 3300042643 | Bacteria | 4053 |
| 96 | Ga0466727_183395 | 3300042655 | Bacteria | 1525 |
| 97 | Ga0466705_347272 | 3300042612 | Bacteria | 7930 |
| 98 | Ga0466733_115483 | 3300042659 | Bacteria | 8446 |
| 99 | Ga0466711_064355 | 3300042615 | Bacteria | 6349 |
| 100 | Ga0466711_179304 | 3300042615 | Bacteria | 27581 |
| 101 | Ga0466711_297018 | 3300042615 | Bacteria | 6417 |
| 102 | Ga0466718_057201 | 3300042617 | Bacteria | 25599 |
| 103 | Ga0466723_141358 | 3300042618 | Bacteria | 5637 |
| 104 | Ga0466728_009135 | 3300042620 | Bacteria | 2833 |
| 105 | Ga0466728_050488 | 3300042620 | Bacteria | 26200 |
| 106 | Ga0466728_305854 | 3300042620 | Bacteria | 4224 |
| 107 | Ga0466729_074884 | 3300042621 | Bacteria | 1797 |
| 108 | Ga0123353_10285715 | 3300010167 | Bacteria | 2530 |
| 109 | Ga0466690_088052 | 3300042590 | Bacteria | 7601 |
| 110 | Ga0466690_103018 | 3300042590 | Bacteria | 2681 |
| 111 | Ga0466694_121961 | 3300042594 | Bacteria | 1592 |
| 112 | Ga0466694_347671 | 3300042594 | Bacteria | 1704 |
| 113 | Ga0466735_010056 | 3300042624 | Bacteria | 1997 |
| 114 | Ga0466704_140776 | 3300042643 | Bacteria | 46136 |
| 115 | Ga0466704_251320 | 3300042643 | Bacteria | 235343 |
| 116 | Ga0466722_033940 | 3300042609 | Bacteria | 5583 |
| 117 | Ga0466722_036609 | 3300042609 | Bacteria | 22552 |
| 118 | Ga0466722_096266 | 3300042609 | Bacteria | 1635 |
| 119 | Ga0466722_173350 | 3300042609 | Bacteria | 2211 |
| 120 | Ga0466705_061131 | 3300042612 | Bacteria | 3303 |
| 121 | Ga0466705_147544 | 3300042612 | Bacteria | 2721 |
| 122 | Ga0466711_201079 | 3300042615 | Bacteria | 18389 |
| 123 | Ga0466715_110262 | 3300042616 | Bacteria | 4404 |
| 124 | Ga0466723_078820 | 3300042618 | Bacteria | 5597 |
| 125 | Ga0466728_028089 | 3300042620 | Bacteria | 2871 |
| 126 | Ga0123356_10028155 | 3300010049 | Bacteria | 5264 |
| 127 | Ga0123354_10030382 | 3300010882 | Unclassified | 8487 |
| 128 | Ga0466691_014463 | 3300042593 | Bacteria | 6506 |
| 129 | Ga0466691_022131 | 3300042593 | Bacteria | 16738 |
| 130 | Ga0466694_259445 | 3300042594 | Bacteria | 1782 |
| 131 | Ga0466696_077829 | 3300042596 | Bacteria | 45805 |
| 132 | Ga0466696_088062 | 3300042596 | Bacteria | 1562 |
| 133 | Ga0466699_323566 | 3300042597 | Bacteria | 2743 |
| 134 | Ga0466703_128509 | 3300042636 | Bacteria | 11681 |
| 135 | Ga0466703_155494 | 3300042636 | Bacteria | 2470 |
| 136 | Ga0466704_110898 | 3300042643 | Bacteria | 2363 |
| 137 | Ga0466704_558037 | 3300042643 | Bacteria | 27638 |
| 138 | Ga0466709_003002 | 3300042648 | Bacteria | 2381 |
| 139 | Ga0466709_086355 | 3300042648 | Bacteria | 5095 |
| 140 | Ga0466709_101967 | 3300042648 | Bacteria | 3973 |
| 141 | Ga0466709_304921 | 3300042648 | Bacteria | 14927 |
| 142 | Ga0466708_025624 | 3300042652 | Bacteria | 9770 |
| 143 | Ga0466708_035960 | 3300042652 | Bacteria | 2922 |
| 144 | Ga0466707_375656 | 3300042601 | Bacteria | 1366 |
| 145 | Ga0466716_061951 | 3300042605 | Bacteria | 5252 |
| 146 | Ga0466716_463671 | 3300042605 | Bacteria | 4153 |
| 147 | Ga0466719_345437 | 3300042606 | Bacteria | 6426 |
| 148 | Ga0466722_169765 | 3300042609 | Bacteria | 1829 |
| 149 | Ga0466705_236602 | 3300042612 | Bacteria | 26817 |
| 150 | Ga0466705_239673 | 3300042612 | Unclassified | 11872 |
| 151 | Ga0466733_200454 | 3300042659 | Bacteria | 20916 |
| 152 | Ga0466711_287578 | 3300042615 | Bacteria | 2509 |
| 153 | Ga0466715_532066 | 3300042616 | Bacteria | 12908 |
| 154 | Ga0466723_021883 | 3300042618 | Bacteria | 3521 |
| 155 | Ga0466723_046520 | 3300042618 | Bacteria | 9962 |
| 156 | Ga0466723_060388 | 3300042618 | Bacteria | 6422 |
| 157 | Ga0466723_254668 | 3300042618 | Bacteria | 7622 |
| 158 | Ga0466728_262925 | 3300042620 | Bacteria | 2866 |
| 159 | Ga0456237_0007746 | 3300041968 | Unclassified | 1646 |
| 160 | Ga0466690_293884 | 3300042590 | Bacteria | 23409 |
| 161 | Ga0466692_037871 | 3300042591 | Bacteria | 14702 |
| 162 | Ga0466691_122987 | 3300042593 | Bacteria | 3426 |
| 163 | Ga0466691_169536 | 3300042593 | Bacteria | 2278 |
| 164 | Ga0466694_035385 | 3300042594 | Bacteria | 2062 |
| 165 | Ga0466696_143523 | 3300042596 | Bacteria | 9293 |
| 166 | Ga0466699_029809 | 3300042597 | Bacteria | 102248 |
| 167 | Ga0466699_347082 | 3300042597 | Unclassified | 6887 |
| 168 | Ga0466703_165679 | 3300042636 | Bacteria | 6836 |
| 169 | Ga0466704_074713 | 3300042643 | Bacteria | 2533 |
| 170 | Ga0466704_230125 | 3300042643 | Bacteria | 8676 |
| 171 | Ga0466727_001754 | 3300042655 | Bacteria | 2641 |
| 172 | AustNasuHG_c1001888 | 3300000089 | Bacteria | 7551 |
| 173 | Ga0466716_444049 | 3300042605 | Bacteria | 5909 |
| 174 | Ga0466719_500026 | 3300042606 | Bacteria | 3951 |
| 175 | Ga0466722_041812 | 3300042609 | Bacteria | 7002 |
| 176 | Ga0466722_097969 | 3300042609 | Bacteria | 11579 |
| 177 | Ga0466723_112388 | 3300042618 | Bacteria | 2656 |
| 178 | Ga0466726_461670 | 3300042619 | Bacteria | 1229 |
| 179 | Ga0466690_108204 | 3300042590 | Bacteria | 1764 |
| 180 | Ga0466692_102530 | 3300042591 | Bacteria | 9798 |
| 181 | Ga0466692_138507 | 3300042591 | Bacteria | 28367 |
| 182 | Ga0466696_380288 | 3300042596 | Bacteria | 1975 |
| 183 | Ga0466708_205098 | 3300042652 | Bacteria | 9259 |
| 184 | Ga0466708_224279 | 3300042652 | Bacteria | 26088 |
| 185 | Ga0466708_331698 | 3300042652 | Bacteria | 3305 |
| 186 | Ga0068302_10122076 | 3300005071 | Bacteria | 2368 |
| 187 | Ga0466707_176838 | 3300042601 | Bacteria | 1815 |
| 188 | Ga0466707_421928 | 3300042601 | Bacteria | 1599 |
| 189 | Ga0466719_061437 | 3300042606 | Bacteria | 2675 |
| 190 | Ga0466719_074902 | 3300042606 | Bacteria | 2402 |
| 191 | Ga0466719_079151 | 3300042606 | Bacteria | 14019 |
| 192 | Ga0466719_430710 | 3300042606 | Bacteria | 1526 |
| 193 | Ga0466722_216213 | 3300042609 | Bacteria | 2380 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF00691 | OmpA | OmpA family | 348 | 443 | 0.96 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.