Protein Family IF06392
Metagenome
Isolate
109
Members
24
Samples
108
Scaffolds
135.24
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_319932|Ga0466716_319932_805_1257
- Length
- 150 aa
- Sequence
- MLNLAPDLYGLIIAHARAGLPNEACGLFAGEIAGEEKTVRAVYCLKNTEESPEHFSMSPEDQFKAVKDLRQKGLVLLGNFHSHPATPARPSAEDVRLAFDPALSYVIVSLKDAGPALKSFLIRGGIAEEEPVRISPPPELPPSRKSRLSS
Sample Types
Isolate
0.9%
Metagenome
99.1%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
58.3%
Rhinotermitidae
16.7%
Unclassified
12.5%
Termopsidae
12.5%
Taxonomy
Archaea
0
Bacteria
99
Eukaryota
0
Viruses
0
Unclassified
10
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 2 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 3 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 4 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 5 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 6 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 7 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 8 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 9 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 10 | 650716102 | Treponema primitia ZAS-2 | Isolate | Unclassified |
| 11 | 3300005083 | Mastotermes darwiniensis gut microbial communities from University of Queensland, Australia under feeding trial | Metagenome | Unclassified |
| 12 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 13 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 14 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 15 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 16 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 17 | 3300041968 | Termite hindgut microbial communities from Coptotermes formosanus workers in Fort Lauderdale, Florida, USA - CFCB1 | Metagenome | Rhinotermitidae |
| 18 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 19 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 20 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 21 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 22 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 23 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 24 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466707_327809 | 3300042601 | Bacteria | 1350 |
| 2 | Ga0466707_367456 | 3300042601 | Bacteria | 1194 |
| 3 | Ga0466692_143539 | 3300042591 | Bacteria | 3604 |
| 4 | Ga0466711_048141 | 3300042615 | Bacteria | 11115 |
| 5 | Ga0466711_113190 | 3300042615 | Bacteria | 2547 |
| 6 | Ga0466711_331489 | 3300042615 | Bacteria | 14739 |
| 7 | Ga0466711_474700 | 3300042615 | Bacteria | 2415 |
| 8 | Ga0466711_503690 | 3300042615 | Bacteria | 3309 |
| 9 | Ga0466723_034250 | 3300042618 | Bacteria | 5530 |
| 10 | Ga0466726_181189 | 3300042619 | Unclassified | 1176 |
| 11 | Ga0466726_349739 | 3300042619 | Bacteria | 6420 |
| 12 | Ga0466728_007924 | 3300042620 | Bacteria | 7243 |
| 13 | Ga0068305_10051096 | 3300005083 | Bacteria | 3223 |
| 14 | Ga0466703_009635 | 3300042636 | Unclassified | 1353 |
| 15 | Ga0466727_156684 | 3300042655 | Bacteria | 1750 |
| 16 | Ga0466705_274900 | 3300042612 | Bacteria | 3371 |
| 17 | Ga0466707_269241 | 3300042601 | Bacteria | 1147 |
| 18 | Ga0466719_368828 | 3300042606 | Bacteria | 3173 |
| 19 | Ga0466719_520711 | 3300042606 | Bacteria | 1681 |
| 20 | Ga0466711_466513 | 3300042615 | Unclassified | 1687 |
| 21 | Ga0466715_510301 | 3300042616 | Bacteria | 1720 |
| 22 | Ga0466715_626743 | 3300042616 | Unclassified | 2099 |
| 23 | Ga0466723_207353 | 3300042618 | Bacteria | 11683 |
| 24 | Ga0466729_228028 | 3300042621 | Bacteria | 1702 |
| 25 | Ga0466735_101729 | 3300042624 | Bacteria | 3763 |
| 26 | Ga0466735_150129 | 3300042624 | Bacteria | 1741 |
| 27 | Ga0466704_159676 | 3300042643 | Bacteria | 18888 |
| 28 | Ga0466708_028622 | 3300042652 | Unclassified | 1576 |
| 29 | Ga0466727_008237 | 3300042655 | Unclassified | 1912 |
| 30 | Ga0466716_093661 | 3300042605 | Bacteria | 1770 |
| 31 | Ga0466692_052592 | 3300042591 | Bacteria | 2465 |
| 32 | Ga0466711_486154 | 3300042615 | Bacteria | 15628 |
| 33 | Ga0466723_269216 | 3300042618 | Bacteria | 1184 |
| 34 | Ga0466735_061224 | 3300042624 | Bacteria | 1418 |
| 35 | Ga0466704_016894 | 3300042643 | Bacteria | 1112 |
| 36 | Ga0466704_145410 | 3300042643 | Bacteria | 1051 |
| 37 | Ga0466727_310735 | 3300042655 | Bacteria | 2960 |
| 38 | Ga0466707_227193 | 3300042601 | Bacteria | 1960 |
| 39 | Ga0466716_016602 | 3300042605 | Bacteria | 3203 |
| 40 | Ga0466716_396398 | 3300042605 | Bacteria | 3064 |
| 41 | Ga0466719_055457 | 3300042606 | Bacteria | 7769 |
| 42 | Ga0466722_079751 | 3300042609 | Bacteria | 3170 |
| 43 | Ga0466692_192537 | 3300042591 | Bacteria | 6034 |
| 44 | Ga0466715_184173 | 3300042616 | Bacteria | 2381 |
| 45 | Ga0466715_184299 | 3300042616 | Bacteria | 5738 |
| 46 | Ga0466715_387915 | 3300042616 | Bacteria | 2211 |
| 47 | Ga0466723_022730 | 3300042618 | Bacteria | 8220 |
| 48 | Ga0466735_004204 | 3300042624 | Bacteria | 5207 |
| 49 | Ga0466704_187977 | 3300042643 | Bacteria | 4858 |
| 50 | Ga0466709_346527 | 3300042648 | Bacteria | 7568 |
| 51 | Ga0466727_067879 | 3300042655 | Bacteria | 3795 |
| 52 | Ga0466727_074384 | 3300042655 | Bacteria | 6541 |
| 53 | Ga0466727_266748 | 3300042655 | Bacteria | 1304 |
| 54 | Ga0466705_044230 | 3300042612 | Bacteria | 14548 |
| 55 | Ga0466707_372824 | 3300042601 | Bacteria | 1114 |
| 56 | Ga0466716_319932 | 3300042605 | Bacteria | 2805 |
| 57 | Ga0466719_042957 | 3300042606 | Bacteria | 11596 |
| 58 | Ga0466719_324252 | 3300042606 | Bacteria | 3353 |
| 59 | Ga0466719_469768 | 3300042606 | Bacteria | 6381 |
| 60 | Ga0466722_137237 | 3300042609 | Bacteria | 2829 |
| 61 | Ga0466692_020849 | 3300042591 | Bacteria | 1187 |
| 62 | Ga0466692_077763 | 3300042591 | Bacteria | 4671 |
| 63 | Ga0466691_137545 | 3300042593 | Bacteria | 1224 |
| 64 | Ga0466735_034102 | 3300042624 | Bacteria | 3301 |
| 65 | Ga0466735_073481 | 3300042624 | Bacteria | 2483 |
| 66 | Ga0466735_095163 | 3300042624 | Bacteria | 3780 |
| 67 | Ga0466708_389252 | 3300042652 | Bacteria | 1202 |
| 68 | Ga0466727_208840 | 3300042655 | Bacteria | 1387 |
| 69 | Ga0466727_239184 | 3300042655 | Unclassified | 1299 |
| 70 | Ga0466705_176777 | 3300042612 | Unclassified | 3992 |
| 71 | Ga0466707_204655 | 3300042601 | Bacteria | 3430 |
| 72 | Ga0466707_225972 | 3300042601 | Unclassified | 5210 |
| 73 | Ga0466707_234056 | 3300042601 | Bacteria | 1322 |
| 74 | Ga0466719_330273 | 3300042606 | Bacteria | 3118 |
| 75 | Ga0456237_0011545 | 3300041968 | Unclassified | 1288 |
| 76 | Ga0466692_151507 | 3300042591 | Bacteria | 3867 |
| 77 | Ga0466691_175106 | 3300042593 | Bacteria | 13132 |
| 78 | Ga0466715_153562 | 3300042616 | Bacteria | 2810 |
| 79 | Ga0466715_341126 | 3300042616 | Bacteria | 5325 |
| 80 | Ga0466726_207977 | 3300042619 | Bacteria | 3657 |
| 81 | Ga0466726_378770 | 3300042619 | Bacteria | 1525 |
| 82 | Ga0466708_339007 | 3300042652 | Bacteria | 3477 |
| 83 | Ga0466727_082231 | 3300042655 | Bacteria | 1527 |
| 84 | Ga0466705_019741 | 3300042612 | Bacteria | 7263 |
| 85 | Ga0466707_007668 | 3300042601 | Bacteria | 1537 |
| 86 | Ga0466690_131913 | 3300042590 | Bacteria | 3330 |
| 87 | Ga0466715_355752 | 3300042616 | Bacteria | 11975 |
| 88 | Ga0466715_455010 | 3300042616 | Bacteria | 4875 |
| 89 | Ga0466728_031863 | 3300042620 | Bacteria | 4439 |
| 90 | Ga0466735_062386 | 3300042624 | Bacteria | 1799 |
| 91 | Ga0466703_312904 | 3300042636 | Bacteria | 1058 |
| 92 | Ga0466709_204863 | 3300042648 | Bacteria | 7833 |
| 93 | Ga0466692_074521 | 3300042591 | Bacteria | 7164 |
| 94 | Ga0466692_157513 | 3300042591 | Bacteria | 1339 |
| 95 | Ga0466696_022856 | 3300042596 | Bacteria | 8322 |
| 96 | Ga0466711_210185 | 3300042615 | Bacteria | 3706 |
| 97 | Ga0466711_448094 | 3300042615 | Bacteria | 12925 |
| 98 | Ga0466715_357644 | 3300042616 | Bacteria | 8904 |
| 99 | Ga0466723_237179 | 3300042618 | Bacteria | 7123 |
| 100 | Ga0466726_039630 | 3300042619 | Bacteria | 1844 |
| 101 | Ga0466726_050729 | 3300042619 | Bacteria | 8848 |
| 102 | Ga0466729_081663 | 3300042621 | Bacteria | 1314 |
| 103 | Ga0068305_10285267 | 3300005083 | Bacteria | 3236 |
| 104 | Ga0466735_196575 | 3300042624 | Bacteria | 1663 |
| 105 | Ga0466703_206915 | 3300042636 | Bacteria | 8728 |
| 106 | Ga0466703_299170 | 3300042636 | Bacteria | 3400 |
| 107 | Ga0466704_223933 | 3300042643 | Bacteria | 12467 |
| 108 | Ga0466727_128843 | 3300042655 | Bacteria | 1502 |
MSA Aligner
Functional Annotation
| PFAM ID | Name | Description | Start | End | Accuracy |
|---|---|---|---|---|---|
| PF14464 | Prok-JAB | Prokaryotic homologs of the JAB domain | 8 | 113 | 0.85 |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.