Protein Family IF06315
Metagenome
Isolate
123
Members
54
Samples
106
Scaffolds
363.74
Avg Length
Representative Sequence
- ID
- 3300042605|Ga0466716_060526|Ga0466716_060526_5312_6544
- Length
- 410 aa
- Sequence
- MCNSSKILSANKNGSTLFTAENILGKKTESKIGDEENKYHNIMKKIRLFPLLTFICALSGISILSQAQNNQPLRLGVAGLSHGHLWEVVRRADRGDFVIVGVAEKDSLLRAANRLRDKIDASLFYADLEEMLDRAKPEAVIVYESIYDHLRVVELCAPRGIHVMVEKPLAVNMEHAERMAELAKKHKIHLLTNYETTWYNTNHEACGLIREGAIGNITRINVYDGHQGPFEIGCGKEFTDWLTDPVLNGGGAVIDFGCYGANLATWLLKGEKPKCVYGILKQQKPDKYPEVDDDATIIIEYPSAVVQIMASWNWPMNRKDMHIYGSKGYIYQDTPSKMRVYAGQKETTVEPPSLIAPYNDAFYYLKAVVRNEIQMEPYDLSSLENNLWVVRILEAAVKSSESGKIIYFGN
Sample Types
Isolate
13.8%
Metagenome
86.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Blattidae
25.9%
Kalotermitidae
24.1%
Termitidae
22.2%
Rhinotermitidae
7.4%
Termopsidae
7.4%
Passalidae
3.7%
Unclassified
3.7%
Hydrophilidae
3.7%
Formicidae
1.9%
Taxonomy
Archaea
0
Bacteria
115
Eukaryota
0
Viruses
0
Unclassified
8
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 2910942425 | Dysgonomonas sp. 521 | Isolate | Blattidae |
| 2 | 2940212447 | Parabacteroides sp. PH5-16 | Isolate | Blattidae |
| 3 | 2940302308 | Parabacteroides sp. PF5-5 | Isolate | Blattidae |
| 4 | 2940321370 | Parabacteroides sp. PH5-39 | Isolate | Blattidae |
| 5 | 2940332795 | Parabacteroides sp. PH5-8 | Isolate | Blattidae |
| 6 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 7 | 8100166142 | Dysgonomonas sp. GY75 | Isolate | Rhinotermitidae |
| 8 | 3300042594 | Termite gut microbial communities of Coatitermes kartaboensis from Petit Saut, French Guiana, France - Coa324 | Metagenome | Termitidae |
| 9 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 10 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 11 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 12 | 3300042617 | Termite gut microbial communities of Nasutitermes lujae from Ebogo II, Mbalmayo, Cameroon - Nl494 | Metagenome | Termitidae |
| 13 | 2873610414 | Dysgonomonas sp. HDW5B | Isolate | Hydrophilidae |
| 14 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 15 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 16 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 17 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 18 | 3300042659 | Termite gut microbial communities of Odontotermes sp. from Kajiado County, Kenya - TD116 | Metagenome | Termitidae |
| 19 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 20 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 21 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 22 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 23 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 24 | 3300042592 | Termite gut microbial communities of Cornitermes pugnax from Petit Saut, French Guiana, France - Co333 | Metagenome | Termitidae |
| 25 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 26 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 27 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 28 | 2940205530 | Parabacteroides sp. PH5-33 | Isolate | Blattidae |
| 29 | 2940317558 | Parabacteroides sp. PH5-26 | Isolate | Blattidae |
| 30 | 2940325180 | Parabacteroides sp. PH5-41 | Isolate | Blattidae |
| 31 | 3300007140 | Ant gut microbial communities from Cephalotes pallens, Brazil | Metagenome | Formicidae |
| 32 | 2940306115 | Parabacteroides sp. PFB2-22 | Isolate | Blattidae |
| 33 | 2940309933 | Parabacteroides sp. PH5-13 | Isolate | Blattidae |
| 34 | 2940328985 | Parabacteroides sp. PH5-46 | Isolate | Blattidae |
| 35 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 36 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 37 | 3300042625 | Termite gut microbial communities of Sphaerotermes sphaerothorax from Ebogo II, Mbalmayo, Cameroon - Sph363 | Metagenome | Termitidae |
| 38 | 3300042652 | Termite gut microbial communities of Incisitermes marginipennis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Im510 | Metagenome | Kalotermitidae |
| 39 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 40 | 3300042603 | Termite gut microbial communities of Macrotermes cf. amplus from Northern Cameroon, Cameroon - Mx356 | Metagenome | Termitidae |
| 41 | 2873600114 | Dysgonomonas sp. HDW5A | Isolate | Hydrophilidae |
| 42 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
| 43 | 2940195863 | Parabacteroides sp. PF5-6 | Isolate | Blattidae |
| 44 | 2940298504 | Parabacteroides sp. PF5-13 | Isolate | Blattidae |
| 45 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 46 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 47 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 48 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 49 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 50 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 51 | 2940313741 | Parabacteroides sp. PH5-17 | Isolate | Blattidae |
| 52 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 53 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 54 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466697_219490 | 3300042611 | Bacteria | 2306 |
| 2 | Ga0466705_073835 | 3300042612 | Bacteria | 13642 |
| 3 | Ga0466733_156198 | 3300042659 | Bacteria | 2559 |
| 4 | Ga0466726_299490 | 3300042619 | Bacteria | 1841 |
| 5 | Ga0466726_468394 | 3300042619 | Bacteria | 5774 |
| 6 | Ga0466693_060925 | 3300042592 | Bacteria | 1934 |
| 7 | Ga0123356_10303996 | 3300010049 | Bacteria | 1701 |
| 8 | Ga0466703_113650 | 3300042636 | Bacteria | 1153 |
| 9 | Ga0466703_162329 | 3300042636 | Bacteria | 4587 |
| 10 | Ga0466703_393906 | 3300042636 | Bacteria | 3848 |
| 11 | Ga0466727_197256 | 3300042655 | Bacteria | 9258 |
| 12 | JGI24702J35022_10002198 | 3300002462 | Bacteria | 12011 |
| 13 | Ga0068302_10231708 | 3300005071 | Bacteria | 4079 |
| 14 | Ga0466705_310551 | 3300042612 | Unclassified | 1879 |
| 15 | Ga0466733_156258 | 3300042659 | Bacteria | 22768 |
| 16 | Ga0466715_351050 | 3300042616 | Bacteria | 23393 |
| 17 | Ga0466691_049840 | 3300042593 | Bacteria | 5625 |
| 18 | Ga0466694_373091 | 3300042594 | Bacteria | 3319 |
| 19 | Ga0466696_278891 | 3300042596 | Bacteria | 171866 |
| 20 | Ga0466729_298133 | 3300042621 | Unclassified | 1994 |
| 21 | Ga0466735_137502 | 3300042624 | Bacteria | 1932 |
| 22 | Ga0466704_237387 | 3300042643 | Unclassified | 5378 |
| 23 | Ga0466709_242055 | 3300042648 | Bacteria | 39824 |
| 24 | Ga0466708_189255 | 3300042652 | Bacteria | 25954 |
| 25 | Ga0466707_038134 | 3300042601 | Bacteria | 3102 |
| 26 | Ga0466713_122827 | 3300042602 | Bacteria | 174567 |
| 27 | Ga0466716_060526 | 3300042605 | Bacteria | 11534 |
| 28 | Ga0466722_046516 | 3300042609 | Bacteria | 10066 |
| 29 | Ga0466705_084835 | 3300042612 | Bacteria | 10230 |
| 30 | Ga0466733_217788 | 3300042659 | Bacteria | 53499 |
| 31 | Ga0466711_215795 | 3300042615 | Bacteria | 6141 |
| 32 | Ga0466715_195380 | 3300042616 | Bacteria | 5150 |
| 33 | Ga0466728_191258 | 3300042620 | Bacteria | 7033 |
| 34 | Ga0466729_189743 | 3300042621 | Bacteria | 5233 |
| 35 | Ga0466692_063390 | 3300042591 | Bacteria | 95171 |
| 36 | Ga0466735_080909 | 3300042624 | Bacteria | 4736 |
| 37 | Ga0466704_043162 | 3300042643 | Bacteria | 9716 |
| 38 | Ga0466704_434542 | 3300042643 | Bacteria | 4792 |
| 39 | Ga0466704_503296 | 3300042643 | Unclassified | 3375 |
| 40 | Ga0466708_021896 | 3300042652 | Bacteria | 36089 |
| 41 | Ga0466713_040834 | 3300042602 | Bacteria | 17557 |
| 42 | Ga0466719_290663 | 3300042606 | Unclassified | 2861 |
| 43 | Ga0466733_024002 | 3300042659 | Bacteria | 39250 |
| 44 | Ga0466733_061780 | 3300042659 | Bacteria | 7829 |
| 45 | Ga0466726_235413 | 3300042619 | Bacteria | 13638 |
| 46 | Ga0466728_407126 | 3300042620 | Bacteria | 2184 |
| 47 | Ga0466690_257044 | 3300042590 | Bacteria | 11658 |
| 48 | Ga0466691_055328 | 3300042593 | Bacteria | 16815 |
| 49 | Ga0466696_307254 | 3300042596 | Bacteria | 3102 |
| 50 | Ga0466703_169714 | 3300042636 | Bacteria | 1626 |
| 51 | Ga0466704_120171 | 3300042643 | Bacteria | 7058 |
| 52 | 2227469648 | 2225789004 | Unclassified | 4959 |
| 53 | JGI24705J35276_12238381 | 3300002504 | Bacteria | 20559 |
| 54 | Ga0466716_101111 | 3300042605 | Bacteria | 10329 |
| 55 | Ga0466722_007565 | 3300042609 | Bacteria | 18233 |
| 56 | Ga0466722_020017 | 3300042609 | Bacteria | 34997 |
| 57 | Ga0466705_077431 | 3300042612 | Bacteria | 39083 |
| 58 | Ga0466733_038274 | 3300042659 | Bacteria | 12107 |
| 59 | Ga0466711_158971 | 3300042615 | Bacteria | 32433 |
| 60 | Ga0466715_063927 | 3300042616 | Bacteria | 20242 |
| 61 | Ga0466729_020123 | 3300042621 | Bacteria | 18252 |
| 62 | Ga0466703_076131 | 3300042636 | Bacteria | 4530 |
| 63 | Ga0466703_247130 | 3300042636 | Bacteria | 5554 |
| 64 | Ga0466709_221215 | 3300042648 | Bacteria | 16956 |
| 65 | Ga0466709_362123 | 3300042648 | Bacteria | 19052 |
| 66 | JGI24702J35022_10001384 | 3300002462 | Bacteria | 15078 |
| 67 | Ga0068302_10034096 | 3300005071 | Unclassified | 3112 |
| 68 | Ga0466713_148662 | 3300042602 | Bacteria | 25209 |
| 69 | Ga0466714_049830 | 3300042603 | Bacteria | 6027 |
| 70 | Ga0466714_096645 | 3300042603 | Bacteria | 2061 |
| 71 | Ga0466722_041164 | 3300042609 | Bacteria | 8947 |
| 72 | Ga0466718_098654 | 3300042617 | Bacteria | 2909 |
| 73 | Ga0466729_170843 | 3300042621 | Bacteria | 4227 |
| 74 | Ga0466690_161469 | 3300042590 | Bacteria | 6450 |
| 75 | Ga0466692_160817 | 3300042591 | Unclassified | 1293 |
| 76 | Ga0466696_350305 | 3300042596 | Bacteria | 9326 |
| 77 | Ga0466703_203837 | 3300042636 | Bacteria | 13462 |
| 78 | Ga0466704_300355 | 3300042643 | Bacteria | 9268 |
| 79 | Ga0466704_445353 | 3300042643 | Bacteria | 16743 |
| 80 | Ga0466727_159237 | 3300042655 | Bacteria | 9407 |
| 81 | IMNBL1DRAFT_c0004012 | 3300000062 | Bacteria | 9064 |
| 82 | Ga0466700_044544 | 3300042600 | Bacteria | 6401 |
| 83 | Ga0466713_109231 | 3300042602 | Bacteria | 188899 |
| 84 | Ga0466714_035793 | 3300042603 | Bacteria | 2068 |
| 85 | Ga0466705_229291 | 3300042612 | Bacteria | 5475 |
| 86 | Ga0466733_034514 | 3300042659 | Bacteria | 7197 |
| 87 | Ga0466711_193024 | 3300042615 | Bacteria | 1549 |
| 88 | Ga0123356_10015619 | 3300010049 | Bacteria | 7272 |
| 89 | Ga0123353_10336808 | 3300010167 | Bacteria | 2281 |
| 90 | Ga0466730_090213 | 3300042625 | Bacteria | 3971 |
| 91 | Ga0466703_170192 | 3300042636 | Bacteria | 2927 |
| 92 | Ga0466704_066547 | 3300042643 | Bacteria | 4899 |
| 93 | Ga0466704_313163 | 3300042643 | Bacteria | 12079 |
| 94 | IMNBL1DRAFT_c0000971 | 3300000062 | Bacteria | 22123 |
| 95 | Ga0466722_222149 | 3300042609 | Bacteria | 29587 |
| 96 | Ga0466733_073972 | 3300042659 | Bacteria | 2956 |
| 97 | Ga0466692_037359 | 3300042591 | Bacteria | 23412 |
| 98 | Ga0466692_172974 | 3300042591 | Bacteria | 1066 |
| 99 | Ga0466735_084851 | 3300042624 | Bacteria | 3169 |
| 100 | Ga0466703_190015 | 3300042636 | Bacteria | 11527 |
| 101 | Ga0466703_230908 | 3300042636 | Bacteria | 6863 |
| 102 | Ga0466704_064342 | 3300042643 | Bacteria | 12076 |
| 103 | Ga0466704_405992 | 3300042643 | Bacteria | 30758 |
| 104 | Ga0466727_087033 | 3300042655 | Bacteria | 10438 |
| 105 | Ga0102740_1001647 | 3300007140 | Bacteria | 5502 |
| 106 | Ga0466713_100016 | 3300042602 | Bacteria | 46673 |
MSA Aligner
Functional Annotation
Gene Ontology Annotation
| PFAM | GO Term | Description | Category |
|---|---|---|---|
| PF01408 | GO:0000166 | nucleotide binding | MF |
Geographic Distribution
Some samples may be missing due to lack of coordinate data.