Protein Family IF06151
Metagenome
Isolate
112
Members
37
Samples
110
Scaffolds
389.34
Avg Length
Representative Sequence
- ID
- 3300042602|Ga0466713_140716|Ga0466713_140716_1706_2917
- Length
- 403 aa
- Sequence
- MSAIAGAGAIITPGLTACKSSSQTALAAEEALTTGKATAEAADGKIETRTLGKTGITVPVLSMGVMRADNPAVLRAAYNSGITFFDTAHGYQNGKNEEMVGEFFKDKDRSTFYIATKGNPGRRNVPDDYGKAFEEMLNTSLRRLQMDYVDIYYLHGPGSVEDVTNPQVLAAMKKFKSEGKIRHIGFSTHANKPEQIDAAIETGVYEVILISYNFKLNILPELDRAIERGVKAGLGFVAMKTMVGGGTAPAEPWNNNSGPIDGAACLRWVWQNKNIATAIPGFTSFDLLDNCLQAAHNPKFTDEDKKYIAQLGSQELLYCQNCGKCVGDCKKHLPIPDIMRAYMYNYGYRQPSLSKETLAELALGADVCKGCTGCAVKCPSGFKVKEKIAAIAPVVNVPDRFLA
Sample Types
Isolate
1.8%
Metagenome
98.2%
MAG
0.0%
Metatranscriptome
0.0%
Single Cell
0.0%
Taxa Family Distribution
Kalotermitidae
36.1%
Termitidae
27.8%
Termopsidae
11.1%
Unclassified
11.1%
Rhinotermitidae
8.3%
Passalidae
5.6%
Taxonomy
Archaea
0
Bacteria
110
Eukaryota
0
Viruses
1
Unclassified
1
Samples
| # | Sample ID | Description | Type | Taxa Family |
|---|---|---|---|---|
| 1 | 3300002504 | Neocapritermes taracua P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Nt197 P4 | Metagenome | Termitidae |
| 2 | 3300042655 | Termite gut microbial communities of Porotermes quadricollis from Region del Maule, Estero Los Robles, Chile - Pq454 | Metagenome | Termopsidae |
| 3 | 3300042590 | Termite gut microbial communities of Cryptotermes cavifrons from Fort Lauderdale Research & Education Center, Florida, USA - Cc175 | Metagenome | Kalotermitidae |
| 4 | 3300042593 | Termite gut microbial communities of Cryptotermes dudleyi from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cd354 | Metagenome | Kalotermitidae |
| 5 | 3300042606 | Termite gut microbial communities of Neotermes meruensis from Talek, Kenya - Nm470 | Metagenome | Kalotermitidae |
| 6 | 3300042619 | Termite gut microbial communities of Porotermes adamsoni from near Lamington National Park, Queensland, Australia - Po218 | Metagenome | Termopsidae |
| 7 | 2820759988 | Unclassified Bacteroidetes Mp193P4bin4 | Isolate | Unclassified |
| 8 | 3300005201 | Microcerotermes gut microbial communities from Indooroopilly, Australia - IN01 metagenome | Metagenome | |
| 9 | 3300010049 | Embiratermes neotenicus P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P3 | Metagenome | Termitidae |
| 10 | 3300010167 | Labiotermes labralis P3 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P3 | Metagenome | Termitidae |
| 11 | 3300010882 | Labiotermes labralis P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Lab288 P4 | Metagenome | Termitidae |
| 12 | 3300042591 | Termite gut microbial communities of Coptotermes formosanus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Cf509 | Metagenome | Rhinotermitidae |
| 13 | 3300042618 | Termite gut microbial communities of Procryptotermes leewardensis from Pointe de la Grande Vigie, Guadeloupe, France - Pcl387 | Metagenome | Kalotermitidae |
| 14 | 3300000062 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (1ML+1BSL) | Metagenome | Passalidae |
| 15 | 3300002509 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Mp193P4 | Metagenome | Termitidae |
| 16 | 3300042600 | Termite gut microbial communities of Euhamitermes sp. from Bubeng, China - Ehx436 | Metagenome | Termitidae |
| 17 | 3300042602 | Termite gut microbial communities of Mastotermes darwinensis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Md513 | Metagenome | Unclassified |
| 18 | 3300042612 | Termite gut microbial communities of Glyptotermes sp. from Ebogo II, Mbalmayo, Cameroon - Gx485 | Metagenome | Kalotermitidae |
| 19 | 2967483437 | Candidatus Ordinivivax streblomastigis St1 | Isolate | Unclassified |
| 20 | 3300005071 | Porotermes gut microbial communities from Mount Glorious, Queensland, Australia - TN01 | Metagenome | Termopsidae |
| 21 | 3300042621 | Termite gut microbial communities of Reticulitermes flavipes from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Rs511 | Metagenome | Rhinotermitidae |
| 22 | 3300042643 | Termite gut microbial communities of Glyptotermes sp. from Ebogo I, Mbalmayo, Cameroon - Gx481 | Metagenome | Kalotermitidae |
| 23 | 3300042648 | Termite gut microbial communities of Incisitermes snyderi from Fort Lauderdale Research & Education Center, Florida, USA - Iy174 | Metagenome | Kalotermitidae |
| 24 | 3300042596 | Termite gut microbial communities of Calcaritermes temnocephalus from Boquisco, Panama - Ct408 | Metagenome | Kalotermitidae |
| 25 | 3300042605 | Termite gut microbial communities of Neotermes cubanus from Parque Nacional Topes de Collantes, Sierra del Escambray, Cuba - Ncb351 | Metagenome | Kalotermitidae |
| 26 | 3300042616 | Termite gut microbial communities of Neotermes castaneus from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Nc350 | Metagenome | Kalotermitidae |
| 27 | 3300042601 | Termite gut microbial communities of Hodotermopsis sjoestedti from Tam Dao National Park, Vietnam - Hs463 | Metagenome | Unclassified |
| 28 | 3300042609 | Termite gut microbial communities of Prorhinotermes canalifrons from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Pc512 | Metagenome | Rhinotermitidae |
| 29 | 3300042620 | Termite gut microbial communities of Roisinitermes ebogoensis from Ebogo II, Mbalmayo, Cameroon - Roe453 | Metagenome | Kalotermitidae |
| 30 | 3300002462 | Microcerotermes parvus P4 segment gut microbial communities from Pointe-Noire, Republic of the Congo - Th196 P4 | Metagenome | Termitidae |
| 31 | 3300042636 | Termite gut microbial communities of Glyptotermes sp. from Thung Chang, Thailand - Gsp477 | Metagenome | Kalotermitidae |
| 32 | 3300042611 | Termite gut microbial communities of Cubitermes c.f. sulcifrons from Ebogo II, Mbalmayo, Cameroon - Cus372 | Metagenome | Termitidae |
| 33 | 3300042615 | Termite gut microbial communities of Kalotermes flavicollis from BAM Federal Institute for Materials Research and Testing, Berlin, Germany - Kf353 | Metagenome | Kalotermitidae |
| 34 | 2225789004 | Passalidae beetle gut microbial communities from Costa Rica -Larvae (4BL+4ML+4MSL) | Metagenome | Passalidae |
| 35 | 3300009784 | Embiratermes neotenicus P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Emb289 P4 | Metagenome | Termitidae |
| 36 | 3300002834 | Cornitermes sp. P4 segment gut microbial communities from Petit-Saut dam, French Guiana - Co191P4 | Metagenome | Termitidae |
| 37 | 3300042624 | Termite gut microbial communities of Zootermopsis nevadensis from Mount Pinos, Los Padres National Forest, California, USA - Zx50 | Metagenome | Termopsidae |
Scaffolds
| # | Scaffold | Sample | Taxonomy | Length |
|---|---|---|---|---|
| 1 | Ga0466715_079781 | 3300042616 | Bacteria | 19811 |
| 2 | Ga0466715_632327 | 3300042616 | Bacteria | 13777 |
| 3 | Ga0466723_140313 | 3300042618 | Bacteria | 61055 |
| 4 | Ga0466723_224327 | 3300042618 | Bacteria | 5271 |
| 5 | Ga0466727_101102 | 3300042655 | Bacteria | 4542 |
| 6 | Ga0466727_122982 | 3300042655 | Bacteria | 40069 |
| 7 | Ga0466692_030788 | 3300042591 | Bacteria | 34612 |
| 8 | Ga0123354_10000156 | 3300010882 | Bacteria | 54363 |
| 9 | Ga0123354_10286828 | 3300010882 | Bacteria | 1586 |
| 10 | 2227094706 | 2225789004 | Bacteria | 9730 |
| 11 | Ga0466707_301205 | 3300042601 | Bacteria | 10041 |
| 12 | Ga0466719_192439 | 3300042606 | Bacteria | 21840 |
| 13 | Ga0466722_221149 | 3300042609 | Bacteria | 16960 |
| 14 | Ga0466705_091702 | 3300042612 | Bacteria | 3464 |
| 15 | Ga0466705_309809 | 3300042612 | Bacteria | 1710 |
| 16 | Ga0466715_019376 | 3300042616 | Bacteria | 10481 |
| 17 | Ga0466715_026255 | 3300042616 | Bacteria | 31429 |
| 18 | Ga0466726_323435 | 3300042619 | Bacteria | 1869 |
| 19 | Ga0466726_347450 | 3300042619 | Bacteria | 33335 |
| 20 | Ga0466729_270565 | 3300042621 | Bacteria | 6046 |
| 21 | Ga0466704_080054 | 3300042643 | Bacteria | 4215 |
| 22 | Ga0466727_055928 | 3300042655 | Bacteria | 2705 |
| 23 | Ga0466692_038240 | 3300042591 | Bacteria | 2480 |
| 24 | Ga0466692_156077 | 3300042591 | Bacteria | 15779 |
| 25 | Ga0123356_10416906 | 3300010049 | Bacteria | 1484 |
| 26 | Ga0123354_10016367 | 3300010882 | Bacteria | 11619 |
| 27 | IMNBL1DRAFT_c0001060 | 3300000062 | Bacteria | 21260 |
| 28 | JGI24699J35502_11133697 | 3300002509 | Bacteria | 13756 |
| 29 | Ga0466707_231685 | 3300042601 | Bacteria | 4076 |
| 30 | Ga0466707_242973 | 3300042601 | Bacteria | 16990 |
| 31 | Ga0466713_140716 | 3300042602 | Bacteria | 27446 |
| 32 | Ga0466719_482507 | 3300042606 | Bacteria | 3042 |
| 33 | Ga0466705_150477 | 3300042612 | Bacteria | 2523 |
| 34 | Ga0466711_335316 | 3300042615 | Bacteria | 14103 |
| 35 | Ga0466715_434942 | 3300042616 | Bacteria | 16490 |
| 36 | Ga0466729_275550 | 3300042621 | Bacteria | 5376 |
| 37 | Ga0466703_034601 | 3300042636 | Bacteria | 4713 |
| 38 | Ga0466703_039625 | 3300042636 | Bacteria | 8080 |
| 39 | Ga0466709_330887 | 3300042648 | Bacteria | 11774 |
| 40 | Ga0466690_033411 | 3300042590 | Bacteria | 5980 |
| 41 | Ga0123353_10104342 | 3300010167 | Bacteria | 4568 |
| 42 | Ga0123354_10002051 | 3300010882 | Bacteria | 25954 |
| 43 | 2227469382 | 2225789004 | Bacteria | 4963 |
| 44 | JGI24699J35502_11041860 | 3300002509 | Bacteria | 1582 |
| 45 | JGI24699J35502_11134190 | 3300002509 | Bacteria | 48930 |
| 46 | JGI24696J40584_12959266 | 3300002834 | Viruses | 4916 |
| 47 | Ga0123357_10001038 | 3300009784 | Bacteria | 28515 |
| 48 | Ga0466707_008556 | 3300042601 | Bacteria | 2889 |
| 49 | Ga0466707_407745 | 3300042601 | Bacteria | 18219 |
| 50 | Ga0466716_222741 | 3300042605 | Bacteria | 26302 |
| 51 | Ga0466719_470350 | 3300042606 | Bacteria | 3280 |
| 52 | Ga0466705_157525 | 3300042612 | Bacteria | 4711 |
| 53 | Ga0466711_010847 | 3300042615 | Bacteria | 41256 |
| 54 | Ga0466715_074426 | 3300042616 | Bacteria | 5481 |
| 55 | Ga0466723_130968 | 3300042618 | Bacteria | 3652 |
| 56 | Ga0466726_203148 | 3300042619 | Bacteria | 7936 |
| 57 | Ga0466728_300584 | 3300042620 | Bacteria | 10442 |
| 58 | Ga0466735_014708 | 3300042624 | Bacteria | 5306 |
| 59 | Ga0466709_049597 | 3300042648 | Bacteria | 2240 |
| 60 | Ga0466690_034127 | 3300042590 | Bacteria | 10198 |
| 61 | Ga0466690_042712 | 3300042590 | Bacteria | 8144 |
| 62 | Ga0466691_033116 | 3300042593 | Bacteria | 8086 |
| 63 | Ga0466691_116484 | 3300042593 | Bacteria | 13504 |
| 64 | Ga0123357_10094667 | 3300009784 | Bacteria | 3876 |
| 65 | Ga0123357_10104810 | 3300009784 | Bacteria | 3629 |
| 66 | Ga0123354_10285956 | 3300010882 | Bacteria | 1591 |
| 67 | JGI24705J35276_12217820 | 3300002504 | Bacteria | 2113 |
| 68 | Ga0466707_328711 | 3300042601 | Bacteria | 2157 |
| 69 | Ga0466727_348819 | 3300042655 | Bacteria | 3871 |
| 70 | Ga0466723_030107 | 3300042618 | Bacteria | 20038 |
| 71 | Ga0466723_308452 | 3300042618 | Bacteria | 4188 |
| 72 | Ga0466728_081622 | 3300042620 | Bacteria | 4588 |
| 73 | Ga0466735_156234 | 3300042624 | Bacteria | 14530 |
| 74 | Ga0466690_096137 | 3300042590 | Bacteria | 12112 |
| 75 | Ga0466692_043166 | 3300042591 | Bacteria | 27075 |
| 76 | Ga0466696_036809 | 3300042596 | Bacteria | 6517 |
| 77 | Ga0072941_1085555 | 3300005201 | Bacteria | 2627 |
| 78 | Ga0466707_163341 | 3300042601 | Bacteria | 4537 |
| 79 | Ga0466716_025263 | 3300042605 | Bacteria | 7895 |
| 80 | Ga0466697_259107 | 3300042611 | Bacteria | 1333 |
| 81 | Ga0466711_040919 | 3300042615 | Bacteria | 18408 |
| 82 | Ga0466711_116634 | 3300042615 | Bacteria | 4261 |
| 83 | Ga0466715_048593 | 3300042616 | Bacteria | 3511 |
| 84 | Ga0466723_178996 | 3300042618 | Bacteria | 9054 |
| 85 | Ga0123354_10229950 | 3300010882 | Bacteria | 1942 |
| 86 | Ga0466700_051149 | 3300042600 | Bacteria | 14467 |
| 87 | Ga0466713_089566 | 3300042602 | Bacteria | 1939 |
| 88 | Ga0466723_048094 | 3300042618 | Bacteria | 9768 |
| 89 | Ga0466728_080958 | 3300042620 | Bacteria | 5694 |
| 90 | Ga0466735_150369 | 3300042624 | Bacteria | 7637 |
| 91 | Ga0466703_009348 | 3300042636 | Bacteria | 7112 |
| 92 | Ga0466704_062323 | 3300042643 | Bacteria | 6946 |
| 93 | Ga0466704_326796 | 3300042643 | Bacteria | 7022 |
| 94 | Ga0466690_059913 | 3300042590 | Bacteria | 43148 |
| 95 | Ga0466696_227064 | 3300042596 | Bacteria | 35618 |
| 96 | IMNBL1DRAFT_c0001265 | 3300000062 | Bacteria | 19071 |
| 97 | JGI24702J35022_10007620 | 3300002462 | Bacteria | 6191 |
| 98 | JGI24702J35022_10008174 | 3300002462 | Bacteria | 5942 |
| 99 | Ga0068302_10655189 | 3300005071 | Unclassified | 1429 |
| 100 | Ga0466719_396836 | 3300042606 | Bacteria | 2137 |
| 101 | Ga0466704_028752 | 3300042643 | Bacteria | 8447 |
| 102 | Ga0466704_310944 | 3300042643 | Bacteria | 5568 |
| 103 | Ga0466709_237921 | 3300042648 | Bacteria | 101442 |
| 104 | Ga0466727_280080 | 3300042655 | Bacteria | 2874 |
| 105 | Ga0466690_342154 | 3300042590 | Bacteria | 5786 |
| 106 | Ga0466690_371428 | 3300042590 | Bacteria | 9156 |
| 107 | Ga0466696_125373 | 3300042596 | Bacteria | 2315 |
| 108 | Ga0123357_10030365 | 3300009784 | Bacteria | 7325 |
| 109 | Ga0123357_10225557 | 3300009784 | Bacteria | 2067 |
| 110 | Ga0466707_047616 | 3300042601 | Bacteria | 20965 |
MSA Aligner
Functional Annotation
Geographic Distribution
Some samples may be missing due to lack of coordinate data.